PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

FunGene: 08-OCT-2024

⊟Summary

• organism: Staphylococcus aureus JSNZ
• locus tag: JSNZ_000614
• pan locus tag^?: SAUPAN002525000
• symbol: JSNZ_000614
• pan gene symbol^?: fhuC
• synonym:
• product: ABC transporter ATP-binding protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: JSNZ_000614
• symbol: JSNZ_000614
• product: ABC transporter ATP-binding protein
• replicon: chromosome
• strand: +
• coordinates: 649962..650759
• length: 798
• essential: unknown other strains

⊟Accession numbers

• Gene ID:
• RefSeq:
• BioCyc:
• MicrobesOnline:

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  481
  541
  601
  661
  721
  781
  
  ATGAATCGTTTGCATGGACAACAAGTTAAAATTGGTTACGGGGATAACACGATTATAAAT
  AAATTAGATGTTGAAATACCAGATGGCAAAGTGACGTCAATCATTGGTCCTAACGGCTGC
  GGGAAATCTACTTTGCTAAAGGTATTGTCACGTTTATTGGCAGTTAAAGAAGGCGAAGTA
  TTTTTAGATGGTGAAAATATTCATACACAATCTACGAAAGAGATTGCAAAAAAAATAGCC
  ATTTTACCTCAATCACCTGAAGTAGCAGATGGCTTAACTGTTGGGGAATTAGTTTCATAT
  GGTCGTTTTCCACATCAAAAAGGATTTGGTAGATTAACTGCTGAGGATAAGAAAGAAATT
  GATTGGGCAATGGAAGTTACAGGAACTGATACATTCCGACACCGTTCAATCAATGATTTA
  AGTGGTGGTCAAAGACAACGTGTTTGGATTGCAATGGCATTAGCACAAAGAACTGATATT
  ATCTTTTTAGACGAACCAACAACATATTTAGATATCTGTCATCAATTAGAAATACTAGAA
  TTAGTTCAGAAGCTAAATCAGGAACAAGGTTGTACAATTGTCATGGTTCTTCATGATATC
  AACCAAGCGATTCGTTTCTCAGATCATCTTATTGCGATGAAAGAAGGGGATATCATCGCT
  ACAGGTTCAACAGAAGACGTATTAACACAGGAAATATTAGAAAAAGTTTTTAATATTGAT
  GTTGTTTTAAGTAAAGATCCTAAAACTGGAAAACCTTTACTGGTAACTTATGACTTATGT
  CGCAGAGCTTATTCTTAA
  60
  120
  180
  240
  300
  360
  420
  480
  540
  600
  660
  720
  780
  798
  

⊟Protein

⊟General

• locus tag: JSNZ_000614
• symbol: JSNZ_000614
• description: ABC transporter ATP-binding protein
• length: 265
• theoretical pI: 5.63919
• theoretical MW: 29523.7
• GRAVY: -0.180377

⊟Function

• TIGRFAM:
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 233.2)
  and 81 more
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 155.5)
  Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 154.7)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 151.6)
  Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 144.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 143.5)
  Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 141)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 132.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 127.3)
  Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 125.3)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 125)
  Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 120.8)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 118.2)
  Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 115.4)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 114.9)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 113.8)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 113.2)
  Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 112.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 112.2)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 111.2)
  Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 110.7)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 109.7)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 109.2)
  Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)
  Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)
  Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 108)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 107.3)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 106.1)
  Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 106.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 105.4)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 103.4)
  Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 103.3)
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 103.2)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 101.9)
  Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 101.6)
  Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 101.6)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 101.2)
  Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 101.2)
  Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 101.2)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 99.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 99.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 99.4)
  Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 98.8)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 98.7)
  Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 98.7)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 97.7)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 96)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 94.4)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 94.4)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.5)
  Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.5)
  Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.2)
  Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.2)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 88.7)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 88.3)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 87.8)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 86.2)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 82.6)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 76.3)
  Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 71.6)
  Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 69.3)
  Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 67.8)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 66.7)
  Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 66.1)
  Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 63.2)
  Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 57.8)
  Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 57.8)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 52.2)
  Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 50.9)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 48.8)
  Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 47.9)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 21.7)
  Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 16.9)
  Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 16.9)
  4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit (TIGR02305; EC 4.1.1.68,5.3.3.10; HMM-score: 16.4)
  carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 15.3)
  DNA repair and recombination protein RadB (TIGR02237; HMM-score: 13.9)
  Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.4)
  Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AA (TIGR02858; HMM-score: 13.4)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.2)
  4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit (TIGR02303; EC 4.1.1.68,5.3.3.10; HMM-score: 12.1)
  type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 9.8)
• TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
• PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 120.9)
  and 36 more
  SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 37.2)
  AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 36.9)
  AAA_15; AAA ATPase domain (PF13175; HMM-score: 34.7)
  ABC_ATPase; P-loop domain (PF09818; HMM-score: 28.8)
  AAA_14; AAA domain (PF13173; HMM-score: 26.7)
  Rad17; Rad17 P-loop domain (PF03215; HMM-score: 24.6)
  AAA_23; AAA domain (PF13476; HMM-score: 23.9)
  AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 22.4)
  AAA_25; AAA domain (PF13481; HMM-score: 19.6)
  RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.8)
  ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.3)
  AAA_22; AAA domain (PF13401; HMM-score: 17)
  AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 16.7)
  AAA_28; AAA domain (PF13521; HMM-score: 16)
  AAA_18; AAA domain (PF13238; HMM-score: 15.9)
  Spore_III_AA; Sporulation stage III, protein AA (PF19568; HMM-score: 15.8)
  AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.7)
  Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.9)
  NACHT; NACHT domain (PF05729; HMM-score: 14.9)
  AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.8)
  RNA_helicase; RNA helicase (PF00910; HMM-score: 14.4)
  AAA_33; AAA domain (PF13671; HMM-score: 14.2)
  DUF2813; Protein of unknown function (DUF2813) (PF11398; HMM-score: 14)
  ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 13.9)
  AAA_30; AAA domain (PF13604; HMM-score: 13.7)
  APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13.6)
  AAA_19; AAA domain (PF13245; HMM-score: 13.6)
  NADP_Rossmann (CL0063) NAD_binding_2; NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446; HMM-score: 13.4)
  P-loop_NTPase (CL0023) AAA_27; AAA domain (PF13514; HMM-score: 13.4)
  NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.2)
  DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 12.9)
  AAA_24; AAA domain (PF13479; HMM-score: 12.2)
  MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.1)
  SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 12.1)
  MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 11.8)
  DUF6079; Family of unknown function (DUF6079) (PF19557; HMM-score: 10.5)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 1.05
  • Cytoplasmic Membrane Score: 8.78
  • Cellwall Score: 0.08
  • Extracellular Score: 0.09
  • Internal Helices: 0
• DeepLocPro: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.0975
  • Cytoplasmic Membrane Score: 0.9018
  • Cell wall & surface Score: 0
  • Extracellular Score: 0.0008
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.013181
  • TAT(Tat/SPI): 0.000283
  • LIPO(Sec/SPII): 0.00213
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI:
• RefSeq:
• UniProt:

⊟Protein sequence

• MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKVLSRLLAVKEGEVFLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEIDWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILELVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNIDVVLSKDPKTGKPLLVTYDLCRRAYS

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator: Fur* (repression) regulon

  Fur*

  (TF)

  important in Iron homeostasis; transcription unit predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026)

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications