From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000614
  • pan locus tag?: SAUPAN002525000
  • symbol: JSNZ_000614
  • pan gene symbol?: fhuC
  • synonym:
  • product: ABC transporter ATP-binding protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000614
  • symbol: JSNZ_000614
  • product: ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 649962..650759
  • length: 798
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAATCGTTTGCATGGACAACAAGTTAAAATTGGTTACGGGGATAACACGATTATAAAT
    AAATTAGATGTTGAAATACCAGATGGCAAAGTGACGTCAATCATTGGTCCTAACGGCTGC
    GGGAAATCTACTTTGCTAAAGGTATTGTCACGTTTATTGGCAGTTAAAGAAGGCGAAGTA
    TTTTTAGATGGTGAAAATATTCATACACAATCTACGAAAGAGATTGCAAAAAAAATAGCC
    ATTTTACCTCAATCACCTGAAGTAGCAGATGGCTTAACTGTTGGGGAATTAGTTTCATAT
    GGTCGTTTTCCACATCAAAAAGGATTTGGTAGATTAACTGCTGAGGATAAGAAAGAAATT
    GATTGGGCAATGGAAGTTACAGGAACTGATACATTCCGACACCGTTCAATCAATGATTTA
    AGTGGTGGTCAAAGACAACGTGTTTGGATTGCAATGGCATTAGCACAAAGAACTGATATT
    ATCTTTTTAGACGAACCAACAACATATTTAGATATCTGTCATCAATTAGAAATACTAGAA
    TTAGTTCAGAAGCTAAATCAGGAACAAGGTTGTACAATTGTCATGGTTCTTCATGATATC
    AACCAAGCGATTCGTTTCTCAGATCATCTTATTGCGATGAAAGAAGGGGATATCATCGCT
    ACAGGTTCAACAGAAGACGTATTAACACAGGAAATATTAGAAAAAGTTTTTAATATTGAT
    GTTGTTTTAAGTAAAGATCCTAAAACTGGAAAACCTTTACTGGTAACTTATGACTTATGT
    CGCAGAGCTTATTCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    798

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_000614
  • symbol: JSNZ_000614
  • description: ABC transporter ATP-binding protein
  • length: 265
  • theoretical pI: 5.63919
  • theoretical MW: 29523.7
  • GRAVY: -0.180377

⊟Function[edit | edit source]

  • TIGRFAM:
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 233.2)
    and 81 more
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 155.5)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 154.7)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 151.6)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 144.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 143.5)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 141)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 132.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 127.3)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 125.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 125)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 120.8)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 118.2)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 115.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 114.9)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 113.8)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 113.2)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 112.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 112.2)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 111.2)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 110.7)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 109.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 109.2)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 108)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 107.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 106.1)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 106.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 105.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 103.4)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 103.3)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 103.2)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 101.9)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 101.6)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 101.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 101.2)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 101.2)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 101.2)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 99.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 99.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 99.4)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 98.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 98.7)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 98.7)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 97.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 96)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 94.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 94.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.5)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.5)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.2)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 88.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 88.3)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 87.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 86.2)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 82.6)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 76.3)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 71.6)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 69.3)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 67.8)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 66.7)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 66.1)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 63.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 57.8)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 57.8)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 52.2)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 50.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 48.8)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 47.9)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 21.7)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 16.9)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 16.9)
    4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit (TIGR02305; EC 4.1.1.68,5.3.3.10; HMM-score: 16.4)
    carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 15.3)
    DNA repair and recombination protein RadB (TIGR02237; HMM-score: 13.9)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.4)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AA (TIGR02858; HMM-score: 13.4)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.2)
    4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit (TIGR02303; EC 4.1.1.68,5.3.3.10; HMM-score: 12.1)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 9.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 120.9)
    and 36 more
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 37.2)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 36.9)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 34.7)
    ABC_ATPase; P-loop domain (PF09818; HMM-score: 28.8)
    AAA_14; AAA domain (PF13173; HMM-score: 26.7)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 24.6)
    AAA_23; AAA domain (PF13476; HMM-score: 23.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 22.4)
    AAA_25; AAA domain (PF13481; HMM-score: 19.6)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.8)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.3)
    AAA_22; AAA domain (PF13401; HMM-score: 17)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 16.7)
    AAA_28; AAA domain (PF13521; HMM-score: 16)
    AAA_18; AAA domain (PF13238; HMM-score: 15.9)
    Spore_III_AA; Sporulation stage III, protein AA (PF19568; HMM-score: 15.8)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.7)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.9)
    NACHT; NACHT domain (PF05729; HMM-score: 14.9)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.8)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 14.4)
    AAA_33; AAA domain (PF13671; HMM-score: 14.2)
    DUF2813; Protein of unknown function (DUF2813) (PF11398; HMM-score: 14)
    ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 13.9)
    AAA_30; AAA domain (PF13604; HMM-score: 13.7)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13.6)
    AAA_19; AAA domain (PF13245; HMM-score: 13.6)
    NADP_Rossmann (CL0063) NAD_binding_2; NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446; HMM-score: 13.4)
    P-loop_NTPase (CL0023) AAA_27; AAA domain (PF13514; HMM-score: 13.4)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.2)
    DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 12.9)
    AAA_24; AAA domain (PF13479; HMM-score: 12.2)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.1)
    SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 12.1)
    MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 11.8)
    DUF6079; Family of unknown function (DUF6079) (PF19557; HMM-score: 10.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0975
    • Cytoplasmic Membrane Score: 0.9018
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0008
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013181
    • TAT(Tat/SPI): 0.000283
    • LIPO(Sec/SPII): 0.00213
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKVLSRLLAVKEGEVFLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEIDWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILELVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNIDVVLSKDPKTGKPLLVTYDLCRRAYS

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: Fur* (repression) regulon
    Fur*(TF)important in Iron homeostasis;  regulation predicted or transferred from N315 and NCTC 8325  [2]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_000614&oldid=106255"