Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000425
- pan locus tag?: SAUPAN002221000
- symbol: yabA
- pan gene symbol?: —
- synonym:
- product: DNA replication initiation control protein YabA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000425
- symbol: yabA
- product: DNA replication initiation control protein YabA
- replicon: chromosome
- strand: +
- coordinates: 458445..458792
- length: 348
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGGATCGCAATGAAATATTTGAAAAAATAATGCGTTTAGAAATGAATGTCAATCAACTT
TCAAAGGAAACTTCAGAATTAAAGGCACTTGCAGTTGAATTAGTAGAAGAAAATGTAGCG
CTTCAACTTGAAAATGATAATTTGAAAAAGGTGTTGGGCAATGATGAACCAACTACTATT
GATACTGCGAATTCAAAACCAGCAAAAGCTGTGAAAAAGCCATTACCAAGTAAAGATAAT
TTGGCTATATTGTATGGAGAAGGATTTCATATTTGTAAAGGCGAATTATTTGGAAAACAT
CGACATGGTGAAGATTGTCTGTTCTGTTTAGAAGTTTTAAGTGATTAA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000425
- symbol: YabA
- description: DNA replication initiation control protein YabA
- length: 115
- theoretical pI: 4.81782
- theoretical MW: 12925.7
- GRAVY: -0.426957
⊟Function[edit | edit source]
- TIGRFAM: SH3 domain protein (TIGR04211; HMM-score: 12.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined YabA; Initiation control protein YabA (PF06156; HMM-score: 98.6)and 4 moreTSC22; TSC-22/dip/bun family (PF01166; HMM-score: 16.2)FtsL (CL0225) ZapB; Cell division protein ZapB (PF06005; HMM-score: 14.6)no clan defined NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 10.2)bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 9.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9935
- Cytoplasmic Membrane Score: 0.002
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.004
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010582
- TAT(Tat/SPI): 0.000551
- LIPO(Sec/SPII): 0.000378
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLGNDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVLSD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_000423 > JSNZ_000424 > yabA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)