From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0444 [new locus tag: SA_RS02560 ]
  • pan locus tag?: SAUPAN002221000
  • symbol: SA0444
  • pan gene symbol?:
  • synonym:
  • product: DNA replication intiation control protein YabA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0444 [new locus tag: SA_RS02560 ]
  • symbol: SA0444
  • product: DNA replication intiation control protein YabA
  • replicon: chromosome
  • strand: +
  • coordinates: 516454..516822
  • length: 369
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATTAAGGAGGCATTATTACATTTGGATCGCAATGAAATATTTGAAAAAATAATGCGTTTA
    GAAATGAATGTCAATCAACTTTCAAAGGAAACTTCAGAATTAAAGGCACATGCAGTTGAA
    TTAGTAGAAGAAAATGTAGCGCTTCAACTTGAAAATGATAATTTGAAAAAGGTGTTGGGC
    AATGATGAACCAACTACTATTGATACTGCGAATTCAAAACCAGCAAAAGCTGTGAAAAAG
    CCATTACCAAGTAAAGATAATTTGGCTATATTGTATGGAGAAGGATTTCATATTTGTAAA
    GGCGAATTATTTGGAAAACATCGACATGGTGAAGATTGTCTGTTCTGTTTAGAAGTTTTA
    AGTGATTAA
    60
    120
    180
    240
    300
    360
    369

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0444 [new locus tag: SA_RS02560 ]
  • symbol: SA0444
  • description: DNA replication intiation control protein YabA
  • length: 122
  • theoretical pI: 5.2631
  • theoretical MW: 13754.7
  • GRAVY: -0.438525

Function[edit | edit source]

  • TIGRFAM:
    SH3 domain protein (TIGR04211; HMM-score: 13)
  • TheSEED  :
    • DNA replication intiation control protein YabA
    Stress Response Heat shock Heat shock dnaK gene cluster extended  DNA replication intiation control protein YabA
  • PFAM:
    no clan defined YabA; Initiation control protein YabA (PF06156; HMM-score: 97.9)
    and 6 more
    TSC22; TSC-22/dip/bun family (PF01166; HMM-score: 17.4)
    FtsL (CL0225) ZapB; Cell division protein ZapB (PF06005; HMM-score: 16.7)
    DivIC; Septum formation initiator (PF04977; HMM-score: 13.9)
    Kinetochore (CL0724) Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 13.1)
    bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 10.7)
    no clan defined NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 10.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9926
    • Cytoplasmic Membrane Score: 0.0038
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0031
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00622
    • TAT(Tat/SPI): 0.000477
    • LIPO(Sec/SPII): 0.000283
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKEALLHLDRNEIFEKIMRLEMNVNQLSKETSELKAHAVELVEENVALQLENDNLKKVLGNDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVLSD

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]