From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000123
  • pan locus tag?: SAUPAN001020000
  • symbol: JSNZ_000123
  • pan gene symbol?:
  • synonym:
  • product: YagU family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000123
  • symbol: JSNZ_000123
  • product: YagU family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 146766..147245
  • length: 480
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGGTATATTCATTTATGCTGGAATTATCGGTGGCTTGTTATCTGGAATTGTAAAATTA
    GGTTGGGAGGTCATGTTTCCACCTCGCACACCAGAACGTAATGCAACGAACCCACCTCAA
    GAGTTATTGCAACAATTAGGATTTAGTAGTGAGTTTACGCATCAAACATATACATTTTCA
    AATATGGAATTGCCTTGGGTAAGCTTTATTGTCCACTTTAGTTTTTCTATCGTCATTGCA
    ATTATTTACTGCATATTAGTTAAAAAATACGCTTACTTAGCAATGGGACAAGGTGCTGTT
    TTTGGTATTGCTATTTGGGTATTATTCCACCTTATCATTATGCCAATCATGCATACTGTA
    CCTGCTGTGTGGGATCAACCATTCCAAGAGCATCTGTCAGAATTCTTTGGCCATATCGTC
    TGGATGATGACAATTGAATTAGTGCGACAACATTTTGTCTATCGCTATAAATTAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000123
  • symbol: JSNZ_000123
  • description: YagU family protein
  • length: 159
  • theoretical pI: 7.23127
  • theoretical MW: 18415.7
  • GRAVY: 0.546541

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined DUF1440; Protein of unknown function (DUF1440) (PF07274; HMM-score: 213.8)
    and 3 more
    YqhR; Conserved membrane protein YqhR (PF11085; HMM-score: 17.2)
    DUF1761; Protein of unknown function (DUF1761) (PF08570; HMM-score: 16.9)
    DUF6789; Family of unknown function (DUF6789) (PF20587; HMM-score: 10.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0012
    • Cytoplasmic Membrane Score: 0.9983
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0004
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.169662
    • TAT(Tat/SPI): 0.006864
    • LIPO(Sec/SPII): 0.048968
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQELLQQLGFSSEFTHQTYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAMGQGAVFGIAIWVLFHLIIMPIMHTVPAVWDQPFQEHLSEFFGHIVWMMTIELVRQHFVYRYKLN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: Rex* (repression) regulon, ArcR* (activation) regulon, GraR (repression) regulon
    Rex*(TF)important in Energy metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [1]
    ArcR*(TF)important in Arginine degradation;  regulation predicted or transferred from N315 and NCTC 8325  [1]
    GraR(response regulator)important in cationic antimicrobial peptide (CAMP) resistance;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)
  2. Mélanie Falord, Ulrike Mäder, Aurélia Hiron, Michel Débarbouillé, Tarek Msadek
    Investigation of the Staphylococcus aureus GraSR regulon reveals novel links to virulence, stress response and cell wall signal transduction pathways.
    PLoS One: 2011, 6(7);e21323
    [PubMed:21765893] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]