Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS12645 [old locus tag: EGJ38_002533 ]
- pan locus tag?: SAUPAN006216000
- symbol: EGJ38_RS12645
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS12645 [old locus tag: EGJ38_002533 ]
- symbol: EGJ38_RS12645
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2540999..2541166
- length: 168
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2540999..2541166) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGAGATACGTTATTTCAATAATAATGGCAATTGTATTAGCAATTTGGTCATTTAAACAA
CTGAGTCAAAGTCATTTAGATAGCGGATTTATTTTTTTCTTCATAGTTTATGTGTTGTGT
ATCAGTTGTTTTAATAGCGATAAGCACGATAAAAATAAAAAACGATAG60
120
168
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS12645 [old locus tag: EGJ38_002533 ]
- symbol: EGJ38_RS12645
- description: hypothetical protein
- length: 55
- theoretical pI: 9.81263
- theoretical MW: 6502.73
- GRAVY: 0.514545
⊟Function[edit | edit source]
- TIGRFAM: exosortase F-associated protein (TIGR04127; HMM-score: 16)
- TheSEED: data available for NCTC8325, Newman
- PFAM: no clan defined DUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 15.3)DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 14.6)and 1 moreDUF6358; Family of unknown function (DUF6358) (PF19885; HMM-score: 9.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9602
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0397
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.245933
- TAT(Tat/SPI): 0.001245
- LIPO(Sec/SPII): 0.071632
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_072398195 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRYVISIIMAIVLAIWSFKQLSQSHLDSGFIFFFIVYVLCISCFNSDKHDKNKKR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]