Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2568 [new locus tag: SACOL_RS13455 ]
- pan locus tag?: SAUPAN006216000
- symbol: SACOL2568
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2568 [new locus tag: SACOL_RS13455 ]
- symbol: SACOL2568
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2629955..2630122
- length: 168
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237222 NCBI
- RefSeq: YP_187360 NCBI
- BioCyc: see SACOL_RS13455
- MicrobesOnline: 914039 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGAGATACGTTATTTCAATAATAATGGGAATTGTATTAGCAATTTGGTCATTTAAACAA
CTGAGTCAAAGTCATTTAGATAGCGGATTTATTTTTTTCTTCATAGTTTATGTGTTGTGT
ATCAGTTGTTTTAATAGCGATAAGCACGATAAAAATAAAAAACGATAG60
120
168
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2568 [new locus tag: SACOL_RS13455 ]
- symbol: SACOL2568
- description: hypothetical protein
- length: 55
- theoretical pI: 9.81263
- theoretical MW: 6488.7
- GRAVY: 0.474545
⊟Function[edit | edit source]
- TIGRFAM: exosortase F-associated protein (TIGR04127; HMM-score: 15.6)
- TheSEED: data available for NCTC8325, Newman
- PFAM: EMC6 (CL0706) EMC6; EMC6 (PF07019; HMM-score: 16.7)no clan defined DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 14.2)LysE (CL0292) TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 13.8)and 2 moreno clan defined PqiA; Paraquat-inducible protein A (PF04403; HMM-score: 13.3)DUF6358; Family of unknown function (DUF6358) (PF19885; HMM-score: 8.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9648
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0351
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.19773
- TAT(Tat/SPI): 0.001333
- LIPO(Sec/SPII): 0.077303
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRYVISIIMGIVLAIWSFKQLSQSHLDSGFIFFFIVYVLCISCFNSDKHDKNKKR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]