From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS12620 [old locus tag: EGJ38_002528 ]
  • pan locus tag?: SAUPAN006211000
  • symbol: EGJ38_RS12620
  • pan gene symbol?:
  • synonym:
  • product: FeoB-associated Cys-rich membrane protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS12620 [old locus tag: EGJ38_002528 ]
  • symbol: EGJ38_RS12620
  • product: FeoB-associated Cys-rich membrane protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2535108..2535278
  • length: 171
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2535108..2535278) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGTCAGTCATTATTAACATTTTAATTTTTTTAGCAATTTTCGGATATGCCTTATATACA
    CTAGTAAAATTTTTCAAGCGTTCAAAACAAGGAAAATGTGGTACATGTGACATTAATCGT
    GATTGTTGTGGAACAGAACAGCACACAGCGAATCATTTTCCAGGGAAATAA
    60
    120
    171

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS12620 [old locus tag: EGJ38_002528 ]
  • symbol: EGJ38_RS12620
  • description: FeoB-associated Cys-rich membrane protein
  • length: 56
  • theoretical pI: 9.0099
  • theoretical MW: 6313.41
  • GRAVY: 0.15

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair A/G-specific adenine glycosylase (TIGR01084; EC 3.2.2.-; HMM-score: 13.3)
  • TheSEED: data available for N315, NCTC8325, Newman
  • PFAM:
    no clan defined FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 34.1)
    and 1 more
    TSPAN_4TM-like (CL0347) DUF2569; Protein of unknown function (DUF2569) (PF10754; HMM-score: 13.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0006
    • Cytoplasmic Membrane Score: 0.9949
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0044
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.406294
    • TAT(Tat/SPI): 0.013929
    • LIPO(Sec/SPII): 0.034155
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000111118 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSVIINILIFLAIFGYALYTLVKFFKRSKQGKCGTCDINRDCCGTEQHTANHFPGK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]