From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS11055 [old locus tag: EGJ38_002215 ]
  • pan locus tag?: SAUPAN005703000
  • symbol: rpsJ
  • pan gene symbol?: rpsJ
  • synonym:
  • product: 30S ribosomal protein S10

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS11055 [old locus tag: EGJ38_002215 ]
  • symbol: rpsJ
  • product: 30S ribosomal protein S10
  • replicon: chromosome
  • strand: -
  • coordinates: 2215753..2216061
  • length: 309
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2215753..2216061) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGCAAAACAAAAAATCAGAATCAGATTAAAAGCTTATGATCACCGCGTGATTGATCAA
    TCAGCAGAGAAGATTGTAGAAACAGCGAAACGTTCTGGTGCAGATGTTTCTGGACCAATT
    CCGTTACCAACTGAGAAATCAGTTTACACAATCATCCGTGCCGTGCATAAGTATAAAGAT
    TCACGTGAACAATTCGAACAACGTACACACAAACGTTTAATCGATATTGTAAACCCAACA
    CCAAAAACAGTTGACGCTTTAATGGGCTTAAACTTACCATCTGGTGTAGACATCGAAATC
    AAATTATAA
    60
    120
    180
    240
    300
    309

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS11055 [old locus tag: EGJ38_002215 ]
  • symbol: RpsJ
  • description: 30S ribosomal protein S10
  • length: 102
  • theoretical pI: 10.3739
  • theoretical MW: 11576.4
  • GRAVY: -0.492157

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS10 (TIGR01049; HMM-score: 152.5)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS10 (TIGR01046; HMM-score: 65.1)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined Ribosomal_S10; Ribosomal protein S10p/S20e (PF00338; HMM-score: 129.5)
    and 3 more
    DUF384; Domain of unknown function (DUF384) (PF04064; HMM-score: 15.2)
    PriA_C; Primosomal protein N C-terminal domain (PF18074; HMM-score: 14)
    Phi-29_GP3; Phi-29 DNA terminal protein GP3 (PF05435; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.846
    • Cytoplasmic Membrane Score: 0.026
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.1276
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005469
    • TAT(Tat/SPI): 0.000491
    • LIPO(Sec/SPII): 0.001485
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001118667 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHKYKDSREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]