Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS11055 [old locus tag: EGJ38_002215 ]
- pan locus tag?: SAUPAN005703000
- symbol: rpsJ
- pan gene symbol?: rpsJ
- synonym:
- product: 30S ribosomal protein S10
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS11055 [old locus tag: EGJ38_002215 ]
- symbol: rpsJ
- product: 30S ribosomal protein S10
- replicon: chromosome
- strand: -
- coordinates: 2215753..2216061
- length: 309
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2215753..2216061) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAAAACAAAAAATCAGAATCAGATTAAAAGCTTATGATCACCGCGTGATTGATCAA
TCAGCAGAGAAGATTGTAGAAACAGCGAAACGTTCTGGTGCAGATGTTTCTGGACCAATT
CCGTTACCAACTGAGAAATCAGTTTACACAATCATCCGTGCCGTGCATAAGTATAAAGAT
TCACGTGAACAATTCGAACAACGTACACACAAACGTTTAATCGATATTGTAAACCCAACA
CCAAAAACAGTTGACGCTTTAATGGGCTTAAACTTACCATCTGGTGTAGACATCGAAATC
AAATTATAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS11055 [old locus tag: EGJ38_002215 ]
- symbol: RpsJ
- description: 30S ribosomal protein S10
- length: 102
- theoretical pI: 10.3739
- theoretical MW: 11576.4
- GRAVY: -0.492157
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS10 (TIGR01049; HMM-score: 152.5)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS10 (TIGR01046; HMM-score: 65.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined Ribosomal_S10; Ribosomal protein S10p/S20e (PF00338; HMM-score: 129.5)and 3 moreDUF384; Domain of unknown function (DUF384) (PF04064; HMM-score: 15.2)PriA_C; Primosomal protein N C-terminal domain (PF18074; HMM-score: 14)Phi-29_GP3; Phi-29 DNA terminal protein GP3 (PF05435; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.846
- Cytoplasmic Membrane Score: 0.026
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.1276
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005469
- TAT(Tat/SPI): 0.000491
- LIPO(Sec/SPII): 0.001485
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001118667 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHKYKDSREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]