From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS11005 [old locus tag: EGJ38_002205 ]
  • pan locus tag?: SAUPAN005693000
  • symbol: rpsQ
  • pan gene symbol?: rpsQ
  • synonym:
  • product: 30S ribosomal protein S17

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS11005 [old locus tag: EGJ38_002205 ]
  • symbol: rpsQ
  • product: 30S ribosomal protein S17
  • replicon: chromosome
  • strand: -
  • coordinates: 2210945..2211208
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2210945..2211208) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGAGCGAAAGAAACGATCGTAAAGTTTATGTAGGTAAAGTTGTTTCAGACAAAATGGAC
    AAGACTATTACAGTACTTGTTGAAACTTACAAAACACACAAATTATACGGTAAACGAGTA
    AAATACTCTAAAAAATACAAAACTCATGATGAAAACAATTCAGCTAAATTAGGAGACATT
    GTTAAAATTCAAGAAACTCGTCCTTTATCAGCAACAAAACGTTTTCGTTTAGTAGAGATT
    GTTGAAGAGTCAGTAATTATTTAA
    60
    120
    180
    240
    264

Protein[edit | edit source]

Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: EGJ38_RS11005 [old locus tag: EGJ38_002205 ]
  • symbol: RpsQ
  • description: 30S ribosomal protein S17
  • length: 87
  • theoretical pI: 10.362
  • theoretical MW: 10174.8
  • GRAVY: -0.696552

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03635; HMM-score: 115.3)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03630; HMM-score: 40.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    OB (CL0021) Ribosomal_S17; Ribosomal protein S17 (PF00366; HMM-score: 109.9)
    and 1 more
    PCB_OB; Penicillin-binding protein OB-like domain (PF17092; HMM-score: 14.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.4865
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.5134
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007954
    • TAT(Tat/SPI): 0.000534
    • LIPO(Sec/SPII): 0.001166
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000004086 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSERNDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDENNSAKLGDIVKIQETRPLSATKRFRLVEIVEESVII

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]