From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS05595 [old locus tag: EGJ38_001120 ]
  • pan locus tag?: SAUPAN003394000
  • symbol: EGJ38_RS05595
  • pan gene symbol?: ecb
  • synonym:
  • product: fibrinogen-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS05595 [old locus tag: EGJ38_001120 ]
  • symbol: EGJ38_RS05595
  • product: fibrinogen-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1124621..1124950
  • length: 330
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1124621..1124950) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAAGAATTTTATTGGGAAATCAATTTTAAGCATAGCTGCTATTAGTTTAACGGTA
    TCAACGTTTGCCGGTGAATCTCATGCACAAACTAAAAACGCTGAAACTGTAAAAAAATAT
    AACGAGTATCAAACAAACTTTAAAAAACAAGTAAACAAAAAAGTAGTGGATGCACAAAAA
    ACTGTAAACTTGTTCAAACGTACTAGAACTGTTGCAACACACCGTAAAGCACAAAGAGCT
    GTTAATTTAATTCATTTCCAACACAGCTATGAAAAGAAAAAATTACAAAGACAAATCGAT
    CTAGTTTTAAAATATAATACTTTAAAATAA
    60
    120
    180
    240
    300
    330

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS05595 [old locus tag: EGJ38_001120 ]
  • symbol: EGJ38_RS05595
  • description: fibrinogen-binding protein
  • length: 109
  • theoretical pI: 11.1179
  • theoretical MW: 12622.6
  • GRAVY: -0.669725

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance thiopeptide-type bacteriocin biosynthesis domain (TIGR03891; HMM-score: 14.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined efb-c; Extracellular fibrinogen binding protein C terminal (PF12199; HMM-score: 126.6)
    and 2 more
    SERRATE_Ars2_N; SERRATE/Ars2, N-terminal domain (PF12066; HMM-score: 17.9)
    IDEAL; IDEAL domain (PF08858; HMM-score: 13.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0707
    • Extracellular Score: 0.9287
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 29 aa
    • SP(Sec/SPI): 0.986414
    • TAT(Tat/SPI): 0.002437
    • LIPO(Sec/SPII): 0.009989
    • Cleavage Site: CS pos: 29-30. SHA-QT. Pr: 0.8640
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_123163132 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNAETVKKYNEYQTNFKKQVNKKVVDAQKTVNLFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]