Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1066 [new locus tag: NWMN_RS06020 ]
- pan locus tag?: SAUPAN003394000
- symbol: NWMN_1066
- pan gene symbol?: ecb
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1066 [new locus tag: NWMN_RS06020 ]
- symbol: NWMN_1066
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1170389..1170718
- length: 330
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330653 NCBI
- RefSeq: YP_001332100 NCBI
- BioCyc:
- MicrobesOnline: 3706617 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAAGAATTTTATTGGGAAATCAATTTTAAGCATAGCTGCTATTAGTTTAACGGTA
TCAACGTTTGCCGGTGAATCTCATGCACAAACTAAAAACGTTGAAGCTGCTAAAAAATAT
GATCAGTATCAAACAAACTTTAAAAAACAAGTAAATAAAAAAGTTGTGGATGCACAAAAA
GCTGTAAACTTTTTCAAACGTACAAGAACTGTTGCAACACACCGTAAAGCACAAAGAGCT
GTTAATTTAATTCATTTCCAACACAGTTATGAAAAGAAAAAATTACAAAGACAAATCGAT
CTAGTTTTAAAATATAATACTTTAAAATAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1066 [new locus tag: NWMN_RS06020 ]
- symbol: NWMN_1066
- description: hypothetical protein
- length: 109
- theoretical pI: 11.1179
- theoretical MW: 12596.6
- GRAVY: -0.633027
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical protein, similarity with fibrinogen-binding protein Efb
- PFAM: no clan defined efb-c; Extracellular fibrinogen binding protein C terminal (PF12199; HMM-score: 130.8)and 2 moreSERRATE_Ars2_N; SERRATE/Ars2, N-terminal domain (PF12066; HMM-score: 18.3)IDEAL; IDEAL domain (PF08858; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.73
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0994
- Extracellular Score: 0.9
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: ESHAQTKN
- SignalP: Signal peptide SP(Sec/SPI) length 29 aa
- SP(Sec/SPI): 0.986025
- TAT(Tat/SPI): 0.002738
- LIPO(Sec/SPII): 0.009899
- Cleavage Site: CS pos: 29-30. SHA-QT. Pr: 0.8070
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQKAVNFFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SaeR (activation) regulon
SaeR (TF) important in Virulence; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.