From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002063 [new locus tag: EGJ38_RS10300 ]
  • pan locus tag?: SAUPAN005393000
  • symbol: atpC
  • pan gene symbol?: atpC
  • synonym:
  • product: F0F1 ATP synthase subunit epsilon

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002063 [new locus tag: EGJ38_RS10300 ]
  • symbol: atpC
  • product: F0F1 ATP synthase subunit epsilon
  • replicon: chromosome
  • strand: -
  • coordinates: 2076674..2077078
  • length: 405
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423964 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAATACATTAAACCTAGATATTGTCACTCCTAATGGTTCTGTTTACAATCGTGATAAT
    GTTGAACTCGTTGTTATGCAAACAACAGCTGGTGAGATAGGTGTCATGAGTGGACATATT
    CCAACTGTAGCTGCTTTAAAAACAGGCTTTGTAAAAGTGAAATTTCACGATGGAACTGAA
    TATATTGCTGTAAGCGATGGCTTTGTTGAAGTTAGAAAAGATAAAGTTTCAATCATTGTT
    CAGACTGCAGAAACTGCAAGAGAAATTGATGTTGAAAGAGCTAAATTAGCCAAAGCAAGA
    GCAGAGTCTCACTTGGAAAATGATGACGACAATACTGATATTCATAGAGCCGAAAGAGCT
    TTAGAGAGAGCAAATAACCGTTTGCGTGTGGCTGAATTAAAATAG
    60
    120
    180
    240
    300
    360
    405

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002063 [new locus tag: EGJ38_RS10300 ]
  • symbol: AtpC
  • description: F0F1 ATP synthase subunit epsilon
  • length: 134
  • theoretical pI: 5.65749
  • theoretical MW: 14843.6
  • GRAVY: -0.353731

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase F1, epsilon subunit (TIGR01216; EC 3.6.3.14; HMM-score: 120.2)
    and 2 more
    alternate F1F0 ATPase, F1 subunit epsilon (TIGR03166; EC 3.6.3.-; HMM-score: 46.4)
    PRTRC system protein A (TIGR03735; HMM-score: 13.6)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined ATP-synt_DE_N; ATP synthase, Delta/Epsilon chain, beta-sandwich domain (PF02823; HMM-score: 90.9)
    and 3 more
    ATPD-E_C (CL0753) ATP-synt_DE; ATP synthase, Delta/Epsilon chain, long alpha-helix domain (PF00401; HMM-score: 51)
    no clan defined DUF2016; Domain of unknown function (DUF2016) (PF09436; HMM-score: 13.5)
    Phage_fibre (CL0606) Gp138_C; Gp138, beta helical trimerization domain (PF21930; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8439
    • Cytoplasmic Membrane Score: 0.1035
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0523
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010566
    • TAT(Tat/SPI): 0.003491
    • LIPO(Sec/SPII): 0.000862
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423964 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTEYIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERALERANNRLRVAELK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]