Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2167 [new locus tag: NWMN_RS12515 ]
  • pan locus tag?: SAUPAN005724000
  • symbol: sarV
  • pan gene symbol?: sarV
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2167 [new locus tag: NWMN_RS12515 ]
  • symbol: sarV
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2392731..2393081
  • length: 351
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 5331314 NCBI
  • RefSeq: YP_001333201 NCBI
  • BioCyc:
  • MicrobesOnline: 3707769 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGTAATAAAGTTCAACGTTTTATAGAAGCAGAAAGGGAGTTAAGTCAGTTAAAGCAC
    TGGTTAAAAACAACACATAAGATTTCAATTGAAGAATTTGTAGTCCTTTTTAAAGTGTAT
    GAAGCTGAAAAGATTAGCGGTAAAGAATTGAGGGATACATTACATTTTGAAATGCTATGG
    GATACAAGTAAAATCGATGTGATTATCCGTAAAATCTATAAAAAAGAGCTTATTTCTAAA
    TTGCGTTCTGAAACGGATGAAAGACAAGTATTCTATTTCTATAGTACTTCTCAAAAGAAA
    TTGTTAGATAAAATTACTAAAGAAATAGAAGTGTTAAGCGTTACAAACTAA
    60
    120
    180
    240
    300
    351

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_2167 [new locus tag: NWMN_RS12515 ]
  • symbol: SarV
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 9.64293
  • theoretical MW: 13986.2
  • GRAVY: -0.47069

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 86.5)
    and 4 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 19.4)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism nrdI protein (TIGR00333; HMM-score: 13.8)
  • TheSEED  :
    • Transcriptional regulator SarV (Staphylococcal accessory regulator V)
  • ⊞PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 75.1)
    and 8 more
    MarR; MarR family (PF01047; HMM-score: 27.3)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 18.5)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 18.4)
    DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 17.7)
    no clan defined SBDS_N; Shwachman-Bodian-Diamond syndrome (SBDS) N-terminal domain (PF01172; HMM-score: 17.1)
    GatB_YqeY (CL0279) GatB_Yqey; GatB domain (PF02637; HMM-score: 15)
    no clan defined DUF4874; Domain of unknown function (DUF4874) (PF16173; HMM-score: 14.3)
    GT-B (CL0113) Glyco_transf_28; Glycosyltransferase family 28 N-terminal domain (PF03033; HMM-score: 13.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.912
    • Cytoplasmic Membrane Score: 0.0545
    • Cell wall & surface Score: 0.0009
    • Extracellular Score: 0.0326
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000785
    • TAT(Tat/SPI): 0.00015
    • LIPO(Sec/SPII): 0.000157
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 151222379 NCBI
  • RefSeq: YP_001333201 NCBI
  • UniProt: A0A0H3K9Y8 UniProt

⊟Protein sequence[edit | edit source]

  • MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLWDTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: no polycistronic organisation predicted

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_2167&oldid=71123"
  • This page was last edited on 10 March 2016, at 20:02.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again