From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS09805 [old locus tag: NWMN_1740 ]
  • symbol: NWMN_RS09805
  • product: DNA-binding response regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1941549..1942172
  • length: 624
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1941549..1942172) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1740

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAACAAAGTAATATTAGTAGATGACCATTATATTGTGCGACAAGGATTGCGATTTTTA
    TTATCCACGATTGAAAACATAGAAGTTTTACAAGACTTTGCAGATGGAGAAACATTTTTA
    GAATATTTAAAAGAGCATGAGCACCCTGATATTGTGCTATTAGATTTAGTGATGCCTGGC
    ATGAATGGTATTGAAATTACGGAATATATTAAGGCACATTATCCGGATATTAAAGTTTTG
    GTATTAACAAGTTATGTTGATGATGAACATGTAATTTCAGCAATCAATAAAGGTGCTGAT
    GGTTATGAAATGAAAGACGTTGAGCCTCAGCAATTAATTGAAACTATTAGACGAGTTATG
    AACGGTGAAAAAATGATACATCCTAAGGCACAAGATGTATTCGAAACAGTTAGCCAAAAA
    CCACACTACACGAATAAGTTGTCAAAGAGAGAAATTGAAGTGTTACGTGAAATGGTTAAA
    GGTAAAACAAATAAAGAGATTGCAGAAACTTTATTTGTATCTGAAAAAACAATTAAAACA
    CATGTCAGTCATATATTTAGTAAATTACAAGTTAGCGATCGTACACAAGCAGCAATTTAT
    GCAATGGAAAATAAGTTGATTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS09805 [old locus tag: NWMN_1740 ]
  • symbol: NWMN_RS09805
  • description: DNA-binding response regulator
  • length: 207
  • theoretical pI: 5.57567
  • theoretical MW: 23895.4
  • GRAVY: -0.27971

Function[edit | edit source]

  • TIGRFAM:
    transcriptional regulator EpsA (TIGR03020; HMM-score: 58.4)
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 57.2)
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    and 12 more
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 36.1)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 35.3)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 35.1)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 33.5)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 23.9)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 21.8)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 21.8)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    probable regulatory domain (TIGR03879; HMM-score: 15.2)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 13.5)
  • TheSEED: see NWMN_1740
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 94.8)
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 83.5)
    and 12 more
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 24.2)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 16.5)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 13.7)
    no clan defined TraC_F_IV; TraC protein (PF11130; HMM-score: 13.3)
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.3)
    KORA; TrfB plasmid transcriptional repressor (PF16509; HMM-score: 13.2)
    no clan defined GP68; Gp68-like predicted RNA polymerase component (PF17469; HMM-score: 13.2)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 12.7)
    HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12)
    l-integrase_N (CL0469) Phage_int_SAM_3; Phage integrase, N-terminal SAM-like domain (PF14659; HMM-score: 10.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9984
    • Cytoplasmic Membrane Score: 0.0008
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0008
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002679
    • TAT(Tat/SPI): 0.000066
    • LIPO(Sec/SPII): 0.000207
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPGMNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVMNGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]