Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1905 [new locus tag: SACOL_RS09810 ]
- pan locus tag?: SAUPAN004781000
- symbol: SACOL1905
- pan gene symbol?: airR
- synonym:
- product: LuxR family DNA-binding response regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1905 [new locus tag: SACOL_RS09810 ]
- symbol: SACOL1905
- product: LuxR family DNA-binding response regulator
- replicon: chromosome
- strand: -
- coordinates: 1960362..1960985
- length: 624
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237896 NCBI
- RefSeq: YP_186730 NCBI
- BioCyc: see SACOL_RS09810
- MicrobesOnline: 913353 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAACAAAGTAATATTAGTAGATGACCATTATATTGTGCGACAAGGATTGCGATTTTTA
TTATCCACGATTGAAAACATAGAAGTTTTACAAGACTTTGCAGATGGAGAAACATTTTTA
GAATATTTAAAAGAGCATGAGCACCCTGATATTGTGCTATTAGATTTAGTGATGCCTGGC
ATGAATGGTATTGAAATTACGGAATATATTAAGGCACATTATCCGGATATTAAAGTTTTG
GTATTAACAAGTTATGTTGATGATGAACATGTAATTTCAGCAATCAATAAAGGTGCTGAT
GGTTATGAAATGAAAGACGTTGAGCCTCAGCAATTAATTGAAACTATTAGACGAGTTATG
AACGGTGAAAAAATGATACATCCTAAGGCACAAGATGTATTCGAAACAGTTAGCCAAAAA
CCACACTACACGAATAAGTTGTCAAAGAGAGAAATTGAAGTGTTACGTGAAATGGTTAAA
GGTAAAACAAATAAAGAGATTGCAGAAACTTTATTTGTATCTGAAAAAACAATTAAAACA
CATGTCAGTCATATATTTAGTAAATTACAAGTTAGCGATCGTACACAAGCAGCAATTTAT
GCAATGGAAAATAAGTTGATTTAG60
120
180
240
300
360
420
480
540
600
624
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1905 [new locus tag: SACOL_RS09810 ]
- symbol: SACOL1905
- description: LuxR family DNA-binding response regulator
- length: 207
- theoretical pI: 5.57567
- theoretical MW: 23895.4
- GRAVY: -0.27971
⊟Function[edit | edit source]
- TIGRFAM: transcriptional regulator EpsA (TIGR03020; HMM-score: 58.4)Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 57.2)Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)and 12 moreRegulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 36.1)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 35.3)LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 35.1)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 33.5)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 23.9)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.3)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 21.8)proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 21.8)Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)probable regulatory domain (TIGR03879; HMM-score: 15.2)RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 13.5)
- TheSEED :
- Two-component transcriptional response regulator, LuxR family
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 94.8)HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 83.5)and 12 moreSigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 24.2)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19)HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 16.5)Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 13.7)no clan defined TraC_F_IV; TraC protein (PF11130; HMM-score: 13.3)HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.3)KORA; TrfB plasmid transcriptional repressor (PF16509; HMM-score: 13.2)no clan defined GP68; Gp68-like predicted RNA polymerase component (PF17469; HMM-score: 13.2)HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 12.7)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12)l-integrase_N (CL0469) Phage_int_SAM_3; Phage integrase, N-terminal SAM-like domain (PF14659; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9984
- Cytoplasmic Membrane Score: 0.0008
- Cell wall & surface Score: 0
- Extracellular Score: 0.0008
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002679
- TAT(Tat/SPI): 0.000066
- LIPO(Sec/SPII): 0.000207
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPGMNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVMNGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 56 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)