Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 03-AUG-2016

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00996
  • pan locus tag?: SAUPAN003263000
  • symbol: SAOUHSC_00996
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00996
  • symbol: SAOUHSC_00996
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 968680..969150
  • length: 471
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3920396 NCBI
  • RefSeq: YP_499548 NCBI
  • BioCyc: G1I0R-938 BioCyc
  • MicrobesOnline: 1289461 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTAGAAAAACATACGAAAAGATTGCAAATATAAATGGCATGTTTAATATGTTAGAA
    CAACAAATCATTCATAGCCAAGATATGGCTCATTTTAGAAGTGAATTTTTTTACGTCAAT
    CATGAGCATCGAGAAAACTATGAAGCACTCCTAATTTATTACAAAAATAGTATCGACAAT
    CCTATTGTAGATGGTGCATGTTATATTTTAGCCCTACCTGAAATTTTCAATAGTGTTGAT
    GTTTTCGAATCAGAGTTACCATTTTCATGGGTATATGATGAAAATGGCATTACCGAAACA
    ATGAAATCACTTAGCATTCCATTACAATATTTAGTTGCAGCAGCTTTAGAAGTAACTGAT
    GTGAATATATTTAAGCCTTCAGGATTTACAATGGGAATGAATAATTGGAATATTGCTCAA
    ATGCGAATCTTTTGGCAATATACAGCAATTATTAGAAAAGAAGCACTATAA
    60
    120
    180
    240
    300
    360
    420
    471

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00996
  • symbol: SAOUHSC_00996
  • description: hypothetical protein
  • length: 156
  • theoretical pI: 4.62139
  • theoretical MW: 18267.8
  • GRAVY: -0.098718

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108206: hypothetical protein
  • PFAM:
    no clan defined DUF2538; Protein of unknown function (DUF2538) (PF10804; HMM-score: 321.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6902
    • Cytoplasmic Membrane Score: 0.0699
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.2397
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004126
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.000299
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 88194752 NCBI
  • RefSeq: YP_499548 NCBI
  • UniProt: P0A0Q4 UniProt
  • STRING: 93061.SAOUHSC_00996 STRING

⊟Protein sequence[edit | edit source]

  • MSRKTYEKIANINGMFNMLEQQIIHSQDMAHFRSEFFYVNHEHRENYEALLIYYKNSIDNPIVDGACYILALPEIFNSVDVFESELPFSWVYDENGITETMKSLSIPLQYLVAAALEVTDVNIFKPSGFTMGMNNWNIAQMRIFWQYTAIIRKEAL

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: SAOUHSC_00995 < SAOUHSC_00996 < SAOUHSC_00997
    predicted SigA promoter [3] : SAOUHSC_00996 < SAOUHSC_00997 < S407

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser:  [3] 
    Expression Data Browser
    ⊟Multi-gene expression profiles



    Click on any data point to display a description of the corresponding condition!

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ Jump up to: 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

T Oshida, M Sugai, H Komatsuzawa, Y M Hong, H Suginaka, A Tomasz
A Staphylococcus aureus autolysin that has an N-acetylmuramoyl-L-alanine amidase domain and an endo-beta-N-acetylglucosaminidase domain: cloning, sequence analysis, and characterization.
Proc Natl Acad Sci U S A: 1995, 92(1);285-9
[PubMed:7816834] [WorldCat.org] [DOI] (P p)

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00996&oldid=89385"
  • This page was last edited on 11 March 2016, at 07:22.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again