From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0957 [new locus tag: SAUSA300_RS05145 ]
  • pan locus tag?: SAUPAN003263000
  • symbol: SAUSA300_0957
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

ehoM: membrane protein that coordinates halide stress response, cell wall cross-linking and oxacillin resistance by unknown mechanism

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0957 [new locus tag: SAUSA300_RS05145 ]
  • symbol: SAUSA300_0957
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1048806..1049276
  • length: 471
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTAGAAAAACATACGAAAAGATTGCAAATATAAATGGCATGTTTAATATGTTAGAA
    CAACAAATCATTCATAGCCAAGATATGGCTCATTTTAGAAGTGAATTTTTTTACGTCAAT
    CATGAGCATCGAGAAAACTATGAAGCACTCCTAATTTATTACAAAAATAGTATCGACAAT
    CCTATTGTAGATGGTGCATGTTATATTTTAGCCCTACCTGAAATTTTCAATAGTGTTGAT
    GTTTTCGAATCAGAGTTACCATTTTCATGGGTATATGATGAAAATGGCATTACCGAAACA
    ATGAAATCACTTAGCATTCCATTACAATATTTAGTTGCAGCAGCTTTAGAAGTAACTGAT
    GTGAATATATTTAAGCCTTCAGGATTTACAATGGGAATGAATAATTGGAATATTGCTCAA
    ATGCGAATCTTTTGGCAATATACAGCAATTATTAGAAAAGAAGCACTATAA
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0957 [new locus tag: SAUSA300_RS05145 ]
  • symbol: SAUSA300_0957
  • description: hypothetical protein
  • length: 156
  • theoretical pI: 4.62139
  • theoretical MW: 18267.8
  • GRAVY: -0.098718

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108206: hypothetical protein
  • PFAM:
    no clan defined DUF2538; Protein of unknown function (DUF2538) (PF10804; HMM-score: 321.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6902
    • Cytoplasmic Membrane Score: 0.0699
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.2397
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004126
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.000299
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSRKTYEKIANINGMFNMLEQQIIHSQDMAHFRSEFFYVNHEHRENYEALLIYYKNSIDNPIVDGACYILALPEIFNSVDVFESELPFSWVYDENGITETMKSLSIPLQYLVAAALEVTDVNIFKPSGFTMGMNNWNIAQMRIFWQYTAIIRKEAL

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

The article "High-throughput transposon sequencing highlights the cell wall as an important barrier for osmotic stress in methicillin resistant Staphylococcus aureus and underlines a tailored response to different osmotic stressors" identified the DUF2538 domain containing gene SAUSA300_0957 (gene 957) as essential under salt stress. [1]

Literature[edit | edit source]

References[edit | edit source]

  1. Christopher F Schuster, David M Wiedemann, Freja C M Kirsebom, Marina Santiago, Suzanne Walker, Angelika Gründling
    High-throughput transposon sequencing highlights the cell wall as an important barrier for osmotic stress in methicillin resistant Staphylococcus aureus and underlines a tailored response to different osmotic stressors.
    Mol Microbiol: 2020, 113(4);699-717
    [PubMed:31770461] [WorldCat.org] [DOI] (I p)
    Miki Matsuo, Norio Yamamoto, Tomomi Hishinuma, Keiichi Hiramatsu
    Identification of a Novel Gene Associated with High-Level β-Lactam Resistance in Heterogeneous Vancomycin-Intermediate Staphylococcus aureus Strain Mu3 and Methicillin-Resistant S. aureus Strain N315.
    Antimicrob Agents Chemother: 2019, 63(2);
    [PubMed:30455230] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Christopher F Schuster, David M Wiedemann, Freja C M Kirsebom, Marina Santiago, Suzanne Walker, Angelika Gründling
High-throughput transposon sequencing highlights the cell wall as an important barrier for osmotic stress in methicillin resistant Staphylococcus aureus and underlines a tailored response to different osmotic stressors.
Mol Microbiol: 2020, 113(4);699-717
[PubMed:31770461] [WorldCat.org] [DOI] (I p)