From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1004 [new locus tag: SA_RS05695 ]
  • symbol: SA1004
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1136409..1136759
  • length: 351
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAATTTAAAAAATATATATTAACAGGAACATTAGCATTACTTTTATCATCAACTGGG
    ATAGCAACTATAGAAGGGAATAAAGCAGATGCAAGTAGTCTGGACAAATATTTAACTGAA
    AGTCAGTTTCATGATAAACGCATAGCAGAAGAATTAAGAACTTTACTTAACAAATCGAAT
    GTATATGCATTAGCTGCAGGAAGCTTAAATCCATATTATAAACGTACGATTATGATGAAT
    GAATATAGAGCTAAAGCGGCACTTAAGAAAAATGATTTCGTATCAATGGCTGATGCTAAA
    GTTGCATTAGAAAAAATATACAAAGAAATTGATGAAATTATAAATAGATAA
    60
    120
    180
    240
    300
    351

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1004 [new locus tag: SA_RS05695 ]
  • symbol: SA1004
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 9.86614
  • theoretical MW: 13114.1
  • GRAVY: -0.287931

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Involved in expression of fibrinogen binding protein
  • PFAM:
    no clan defined CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 188)
    and 1 more
    TPR (CL0020) M-HEAT_ATR; Serine/threonine-protein kinase ATR, M-HEAT region (PF25030; HMM-score: 15.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0236
    • Extracellular Score: 0.9757
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 31 aa
    • SP(Sec/SPI): 0.922255
    • TAT(Tat/SPI): 0.00225
    • LIPO(Sec/SPII): 0.046518
    • Cleavage Site: CS pos: 31-32. ADA-SS. Pr: 0.6778
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Ilse Jongerius, Jörg Köhl, Manoj K Pandey, Maartje Ruyken, Kok P M van Kessel, Jos A G van Strijp, Suzan H M Rooijakkers
Staphylococcal complement evasion by various convertase-blocking molecules.
J Exp Med: 2007, 204(10);2461-71
[PubMed:17893203] [WorldCat.org] [DOI] (P p)