Jump to navigation
		Jump to search
		
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1056 [new locus tag: SAUSA300_RS05695 ]
- pan locus tag?: SAUPAN003405000
- symbol: SAUSA300_1056
- pan gene symbol?: scc
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1056 [new locus tag: SAUSA300_RS05695 ]
- symbol: SAUSA300_1056
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1153847..1154197
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915173 NCBI
- RefSeq: YP_493754 NCBI
- BioCyc: see SAUSA300_RS05695
- MicrobesOnline: 1292571 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301ATGAAATTTAAAAAATATATATTAACAGGAACATTAGCATTACTTTTATCATCAACTGGG
 ATAGCAACTATAGAAGGGAATAAAGCAGATGCAAGTAGTCTGGACAAATATTTAACTGAA
 AGTCAGTTTCATGATAAACGCATAGCAGAAGAATTAAGAACTTTACTTAACAAATCGAAT
 GTATATGCATTAGCTGCAGGAAGCTTAAATCCATATTATAAACGTACGATTATGATGAAT
 GAATATAGAGCTAAAGCGGCACTTAAGAAAAATGATTTCGTATCAATGGCTGATGCTAAA
 GTTGCATTAGAAAAAATATACAAAGAAATTGATGAAATTATAAATAGATAA60
 120
 180
 240
 300
 351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1056 [new locus tag: SAUSA300_RS05695 ]
- symbol: SAUSA300_1056
- description: hypothetical protein
- length: 116
- theoretical pI: 9.86614
- theoretical MW: 13114.1
- GRAVY: -0.287931
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
 
- DeepLocPro: Extracellular- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0236
- Extracellular Score: 0.9757
 
- LocateP: N-terminally anchored (No CS) - Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: Signal peptide SP(Sec/SPI) length 31 aa- SP(Sec/SPI): 0.922255
- TAT(Tat/SPI): 0.00225
- LIPO(Sec/SPII): 0.046518
- Cleavage Site: CS pos: 31-32. ADA-SS. Pr: 0.6778
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]