From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0096 [new locus tag: NWMN_RS00540 ]
  • pan locus tag?: SAUPAN000975000
  • symbol: capB
  • pan gene symbol?: capB
  • synonym:
  • product: capsular polysaccharide synthesis enzyme CapB

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0096 [new locus tag: NWMN_RS00540 ]
  • symbol: capB
  • product: capsular polysaccharide synthesis enzyme CapB
  • replicon: chromosome
  • strand: +
  • coordinates: 120144..120839
  • length: 696
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGCTACTTATGTCAAAAAAGGAAAATACGACAACAACACTATTTGTATATGAAAAACCA
    AAATCAACAATTAGTGAAAAGTTTCGAGGTATACGTTCAAACATCATGTTTTCAAAAGCA
    AATGGTGAAGTAAAGCGCTTATTGGTTACTTCTGAAAAGCCTGGTGCAGGTAAAAGTACA
    GTTGTATCGAATGTAGCGATTACTTATGCACAAGCAGGCTATAAGACATTAGTTATTGAT
    GGCGATATGCGTAAGCCAACACAAAACTATATTTTTAATGAGCAAAATAATAATGGACTA
    TCAAGCTTAATCATTGGTCGAACGACTATGTCAGAAGCAATTACGTCGACAGAAATTGAA
    AATTTAGATTTGCTAACAGCTGGCCCTGTACCTCCAAATCCATCTGAGTTAATTGGGTCT
    GAAAGGTTCAAAGAATTAGTTGATCTGTTTAATAAACGTTACGACATTATTATTGTCGAT
    ACACCGCCAGTTAATACTGTGACTGATGCACAACTATATGCGCGTGCTATTAAAGATAGT
    CTGTTAGTAATTGATAGTGAAAAAAATGATAAAAATGAAGTTAAAAAAGCAAAAGCACTT
    ATGGAAAAAGCAGGCAGTAACATTCTAGGTGTCATTTTGAACAAGACAAAGGTCGATAAA
    TCTTCTAGTTATTATCACTATTATGGAGATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_0096 [new locus tag: NWMN_RS00540 ]
  • symbol: CapB
  • description: capsular polysaccharide synthesis enzyme CapB
  • length: 231
  • theoretical pI: 9.3191
  • theoretical MW: 25642.1
  • GRAVY: -0.374459

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids capsular exopolysaccharide family (TIGR01007; HMM-score: 312.3)
    and 19 more
    chain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 149.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids exopolysaccharide transport protein family (TIGR01005; HMM-score: 123.8)
    exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 121.2)
    cell division ATPase MinD (TIGR01969; HMM-score: 62)
    Cellular processes Cellular processes Cell division septum site-determining protein MinD (TIGR01968; HMM-score: 42.3)
    Hypothetical proteins Conserved transport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 23.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides cellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 20.7)
    Metabolism Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 20.5)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 20)
    helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 16.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.8)
    signal recognition particle protein SRP54 (TIGR01425; HMM-score: 13.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.4)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage replicative helicase, DnaB family (TIGR03600; HMM-score: 12.9)
    arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 12.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.3)
    Metabolism Energy metabolism Photosynthesis chlorophyllide reductase iron protein subunit X (TIGR02016; HMM-score: 11.9)
  • ⊞TheSEED  :
    • Capsular polysaccharide synthesis enzyme CapB
    • Tyrosine-protein kinase EpsD (EC 2.7.10.2)
    Cell Wall and Capsule Capsular and extracellular polysacchrides Exopolysaccharide Biosynthesis  Tyrosine-protein kinase EpsD (EC 2.7.10.2)
    and 1 more
    Regulation and Cell signaling Regulation and Cell signaling - no subcategory Cell envelope-associated LytR-CpsA-Psr transcriptional attenuators  Tyrosine-protein kinase EpsD (EC 2.7.10.2)
  • ⊞PFAM:
    P-loop_NTPase (CL0023) AAA_31; AAA domain (PF13614; HMM-score: 60)
    and 19 more
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 46.8)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 38.8)
    MipZ; ATPase MipZ (PF09140; HMM-score: 37.9)
    ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 23.9)
    AAA_26; AAA domain (PF13500; HMM-score: 20.2)
    MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 19.4)
    Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 19.3)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 19)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 16.7)
    nSTAND_NTPase7; Novel STAND NTPase 7 (PF24404; HMM-score: 15.1)
    RRM (CL0221) GUCT; GUCT (NUC152) domain (PF08152; HMM-score: 14.6)
    P-loop_NTPase (CL0023) Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 14.2)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.9)
    no clan defined AFOR_N; Aldehyde ferredoxin oxidoreductase, N-terminal domain (PF02730; HMM-score: 13.7)
    P-loop_NTPase (CL0023) APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13)
    no clan defined UvrA_inter; UvrA interaction domain (PF17760; HMM-score: 12.9)
    P-loop_NTPase (CL0023) NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 12.8)
    KTI12; Chromatin associated protein KTI12 (PF08433; HMM-score: 12.7)
    AAA_30; AAA domain (PF13604; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.5796
    • Cytoplasmic Membrane Score: 0.3717
    • Cell wall & surface Score: 0.0016
    • Extracellular Score: 0.0471
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013962
    • TAT(Tat/SPI): 0.002166
    • LIPO(Sec/SPII): 0.001794
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLLMSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • ⊞regulators: CodY (repression) regulon, SigB (activation) regulon

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Daniela Keinhörster, Shilpa Elizabeth George, Christopher Weidenmaier, Christiane Wolz
    Function and regulation of Staphylococcus aureus wall teichoic acids and capsular polysaccharides.
    Int J Med Microbiol: 2019, 309(6);151333
    [PubMed:31362856] [WorldCat.org] [DOI] (I p)
  2. ↑ S Sau, J Sun, C Y Lee
    Molecular characterization and transcriptional analysis of type 8 capsule genes in Staphylococcus aureus.
    J Bacteriol: 1997, 179(5);1614-21
    [PubMed:9045821] [WorldCat.org] [DOI] (P p)
  3. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_0096&oldid=52474"