Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS06985 [old locus tag: SACOL1372 ]
- pan locus tag?: SAUPAN003711000
- symbol: SACOL_RS06985
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS06985 [old locus tag: SACOL1372 ]
- symbol: SACOL_RS06985
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1377411..1377515
- length: 105
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGAATGGTTTAAATTCTGTTATTGGCGCAATGATAATAATTGATAAAAACGCAACAACA
GTTACTATGAATTTTTTAATTTACATCACCTACTATAAATATTAA60
105
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS06985 [old locus tag: SACOL1372 ]
- symbol: SACOL_RS06985
- description: hypothetical protein
- length: 34
- theoretical pI: 8.96457
- theoretical MW: 3890.61
- GRAVY: 0.594118
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNGLNSVIGAMIIIDKNATTVTMNFLIYITYYKY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available