From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00407
  • symbol: SAOUHSC_00407
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 409397..409720
  • length: 324
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATGTTTAATCAAATTAATAATAAAAATGAATTAGAAGAATCATATGAATCTGAGAAA
    AAACGTATAGAGAATGAACTGCAAAATTTAAATGAACTTAGGCATAGAACTCGAAAAGAA
    AATGAACGTAGTTATGATGTTTTTCAATATTTGAAGCACGAAATGAATTATAGTGAAGAT
    GCCCAAAGGAAAATGACGAGAAATATAGAAGCGTATGAGCAAGAAATCAATGAGATAATT
    AGAAAGCAAGAATGGAAATTAGAAGAATATAAAGAAGACTTAAAAAAGTCTTATGAAAAG
    CAGTTAGATAAGCTAAGTGACTGA
    60
    120
    180
    240
    300
    324

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00407
  • symbol: SAOUHSC_00407
  • description: hypothetical protein
  • length: 107
  • theoretical pI: 4.94933
  • theoretical MW: 13457.8
  • GRAVY: -1.69252

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 9)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 9)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    and 4 more
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 5.6)
    two transmembrane protein (TIGR04527; HMM-score: 5.6)
    Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 3.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 3.1)
  • TheSEED  :
    • FIG01107979: hypothetical protein
  • PFAM:
    no clan defined Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 16.5)
    ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 15.6)
    dUTPase (CL0153) Herpes_U55; Human herpesvirus U55 protein (PF06501; HMM-score: 14.1)
    and 15 more
    6PGD_C (CL0106) Octopine_DH; NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain (PF02317; HMM-score: 12.2)
    no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 12.1)
    OVT1; Major antigen, helical domain (PF24423; HMM-score: 12)
    YlqD; YlqD protein (PF11068; HMM-score: 11.3)
    PEP-utilisers_N; PEP-utilising enzyme, N-terminal (PF05524; HMM-score: 10.9)
    LTXXQ-like (CL0515) DUF4890; Domain of unknown function (DUF4890) (PF16231; HMM-score: 10.3)
    no clan defined Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 10.1)
    VBS-like (CL0705) HIP1_clath_bdg; Clathrin-binding domain of Huntingtin-interacting protein 1 (PF16515; HMM-score: 10)
    ATP_synthase (CL0255) V-ATPase_G_2; Vacuolar (H+)-ATPase G subunit (PF16999; HMM-score: 8.3)
    no clan defined Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 8.1)
    CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 8)
    UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 7.3)
    P-loop_NTPase (CL0023) SRPRB; Signal recognition particle receptor beta subunit (PF09439; HMM-score: 6.5)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 6.5)
    no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 4.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.349
    • Cytoplasmic Membrane Score: 0.0534
    • Cell wall & surface Score: 0.022
    • Extracellular Score: 0.5756
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005221
    • TAT(Tat/SPI): 0.000691
    • LIPO(Sec/SPII): 0.001015
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MMFNQINNKNELEESYESEKKRIENELQNLNELRHRTRKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYEKQLDKLSD

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser:  [3] 
    Expression Data Browser
    Multi-gene expression profiles



    Click on any data point to display a description of the corresponding condition!

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Jump up to: 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]