From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2568 [new locus tag: SACOL_RS13455 ]
  • symbol: SACOL2568
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2629955..2630122
  • length: 168
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGAGATACGTTATTTCAATAATAATGGGAATTGTATTAGCAATTTGGTCATTTAAACAA
    CTGAGTCAAAGTCATTTAGATAGCGGATTTATTTTTTTCTTCATAGTTTATGTGTTGTGT
    ATCAGTTGTTTTAATAGCGATAAGCACGATAAAAATAAAAAACGATAG
    60
    120
    168

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2568 [new locus tag: SACOL_RS13455 ]
  • symbol: SACOL2568
  • description: hypothetical protein
  • length: 55
  • theoretical pI: 9.81263
  • theoretical MW: 6488.7
  • GRAVY: 0.474545

Function[edit | edit source]

  • TIGRFAM:
    exosortase F-associated protein (TIGR04127; HMM-score: 15.6)
  • TheSEED: data available for NCTC8325, Newman
  • PFAM:
    EMC6 (CL0706) EMC6; EMC6 (PF07019; HMM-score: 16.7)
    no clan defined DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 14.2)
    LysE (CL0292) TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 13.8)
    and 2 more
    no clan defined PqiA; Paraquat-inducible protein A (PF04403; HMM-score: 13.3)
    DUF6358; Family of unknown function (DUF6358) (PF19885; HMM-score: 8.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9648
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0351
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.19773
    • TAT(Tat/SPI): 0.001333
    • LIPO(Sec/SPII): 0.077303
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRYVISIIMGIVLAIWSFKQLSQSHLDSGFIFFFIVYVLCISCFNSDKHDKNKKR

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]