Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 03-AUG-2016

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00445
  • pan locus tag?: SAUPAN002200000
  • symbol: recR
  • pan gene symbol?: recR
  • synonym:
  • product: recombination protein RecR

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00445
  • symbol: recR
  • product: recombination protein RecR
  • replicon: chromosome
  • strand: +
  • coordinates: 447371..447967
  • length: 597
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3919116 NCBI
  • RefSeq: YP_499027 NCBI
  • BioCyc: G1I0R-413 BioCyc
  • MicrobesOnline: 1288922 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGCATTATCCAGAACCTATATCAAAACTTATTGATAGCTTTATGAAATTGCCAGGCATT
    GGTCCAAAGACAGCCCAACGTCTGGCTTTTCATACCTTAGATATGAAAGAAGACGATGTT
    GTTCAGTTTGCCAAAGCATTAGTAGATGTTAAGAGAGAATTAACATATTGTAGCGTATGT
    GGTCACATTACTGAAAATGATCCATGTTATATTTGTGAAGATAAGCAAAGAGATCGTTCA
    GTTATTTGTGTTGTGGAAGATGACAAAGATGTCATAGCTATGGAAAAAATGAGAGAATAC
    AAAGGTTTATATCACGTTTTACATGGGTCTATTTCGCCTATGGATGGCATTGGACCAGAA
    GATATTAATATTCCTTCATTGATTGAACGCTTGAAAAACGATGAAGTTAGCGAATTAATC
    TTAGCTATGAACCCGAACTTAGAGGGGGAATCTACAGCCATGTATATTTCTAGATTAGTT
    AAGCCTATAGGTATCAAAGTGACGAGATTAGCACAAGGGTTATCGGTAGGTGGCGATTTA
    GAGTATGCTGACGAAGTAACATTATCTAAAGCAATCGCAGGTAGAACAGAAATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    597

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00445
  • symbol: RecR
  • description: recombination protein RecR
  • length: 198
  • theoretical pI: 4.75667
  • theoretical MW: 22099.4
  • GRAVY: -0.191414

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair recombination protein RecR (TIGR00615; HMM-score: 290.7)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvA (TIGR00084; EC 3.6.4.12; HMM-score: 11.4)
  • ⊞TheSEED  :
    • Recombination protein RecR
    DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway  Recombination protein RecR
    and 2 more
    DNA Metabolism DNA replication DNA-replication  Recombination protein RecR
    DNA Metabolism DNA uptake, competence DNA processing cluster  Recombination protein RecR
  • ⊞PFAM:
    Toprim-like (CL0413) Toprim_4; Toprim domain (PF13662; HMM-score: 92.7)
    and 11 more
    HHH (CL0198) RecR_HhH; RecR, helix-hairpin-helix (PF21176; HMM-score: 64.5)
    Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 46.4)
    no clan defined RecR_C; RecR, C-terminal (PF21175; HMM-score: 43.1)
    Tbcl_zf (CL0839) RecR_ZnF; RecR, Cys4-zinc finger domain (PF02132; HMM-score: 35.1)
    HHH (CL0198) HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 22.7)
    HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 19.1)
    HHH_8; Helix-hairpin-helix domain (PF14716; HMM-score: 16.3)
    IMS_HHH; IMS family HHH motif (PF11798; HMM-score: 14.2)
    RING (CL0229) zf-RING_16; RING/Ubox like zinc-binding domain (PF17120; HMM-score: 12.9)
    no clan defined DUF6433; Family of unknown function (DUF6433) (PF20025; HMM-score: 12.7)
    RUBY_RBDX; Rubrerythrin, rubredoxin-like domain (PF21349; HMM-score: 8.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9824
    • Cytoplasmic Membrane Score: 0.0022
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0154
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009138
    • TAT(Tat/SPI): 0.000835
    • LIPO(Sec/SPII): 0.001017
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 88194235 NCBI
  • RefSeq: YP_499027 NCBI
  • UniProt: Q2G0T3 UniProt
  • STRING: 93061.SAOUHSC_00445 STRING

⊟Protein sequence[edit | edit source]

  • MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPEDINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDLEYADEVTLSKAIAGRTEM

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: SAOUHSC_00444 > recR
    predicted SigA promoter [3] : 4.5S RNA > SAOUHSC_00440 > S143 > SAOUHSC_00441 > S144 > SAOUHSC_00442 > SAOUHSC_00444 > recR > S145 > SAOUHSC_00446
    predicted SigA promoter [3] : S143 > SAOUHSC_00441 > S144 > SAOUHSC_00442 > SAOUHSC_00444 > recR
    predicted SigA promoter [3] : SAOUHSC_00444 > recR > S145 > SAOUHSC_00446

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser:  [3] 
    Expression Data Browser
    ⊟Multi-gene expression profiles



    Click on any data point to display a description of the corresponding condition!

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ Jump up to: 3.0 3.1 3.2 3.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00445&oldid=75350"
  • This page was last edited on 10 March 2016, at 23:20.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again