From AureoWiki
Revision as of 18:51, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1730 [new locus tag: NWMN_RS09755 ]
  • pan locus tag?: SAUPAN004764000
  • symbol: NWMN_1730
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1730 [new locus tag: NWMN_RS09755 ]
  • symbol: NWMN_1730
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1930238..1930603
  • length: 366
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAGCATCACGCATTCTATTCGGTATCGGTGTTGGCGTAGCAGCTGGTTTTGTAGTT
    GCACTTCAAGGACGTGACGACAAAAGTGTCAAGAACAACACGATCGATCGTACTGCCCCT
    ACTGGTTCAAAATCAGAACTACAACGTGAATTTGAAACGATTAAACAAAGTTTTAATGAC
    ATTTTAAACTATGGTGTTCAAATTAAAAACGAAAGTGCGGAATTTGGTAGTTCAATTGGT
    GGTGAAATTAAGTCATTACTTGGAAACTTCAAATCTGACATTAATCCTAATATTGAACGT
    TTACAGTCACACATCGAAAATTTACAAAATCGTGGCGAGGATATTGGAAACGAAATTTCT
    AAGTAG
    60
    120
    180
    240
    300
    360
    366

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1730 [new locus tag: NWMN_RS09755 ]
  • symbol: NWMN_1730
  • description: hypothetical protein
  • length: 121
  • theoretical pI: 5.92008
  • theoretical MW: 13211.7
  • GRAVY: -0.490083

⊟Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 16.3)
  • TheSEED  :
    • Hypothetical protein SAV1839
    Membrane Transport Protein translocation across cytoplasmic membrane EcsAB transporter affecting expression and secretion of secretory preproteins  Hypothetical protein SAV1839
  • ⊞PFAM:
    no clan defined YicC-like_C; Endoribonuclease YicC-like, C-terminal (PF08340; HMM-score: 17.7)
    Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 15)
    and 3 more
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 13.2)
    Lectin_N; Hepatic lectin, N-terminal domain (PF03954; HMM-score: 13)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 12.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • ⊞DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0204
    • Cytoplasmic Membrane Score: 0.7761
    • Cell wall & surface Score: 0.0351
    • Extracellular Score: 0.1684
  • ⊞LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: GFVVALQG
  • ⊞SignalP: Signal peptide LIPO(Sec/SPII) length 24 aa
    • SP(Sec/SPI): 0.285764
    • TAT(Tat/SPI): 0.011934
    • LIPO(Sec/SPII): 0.562317
    • Cleavage Site: CS pos: 24-25. LQG-RD. Pr: 0.3957
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFNDILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEISK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • ⊞regulator: SigB (activation) regulon

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_1730&oldid=66982"