From AureoWiki
Revision as of 13:24, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02741
  • pan locus tag?: SAUPAN005997000
  • symbol: SAOUHSC_02741
  • pan gene symbol?: opuCD
  • synonym:
  • product: amino acid ABC transporter permease

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02741
  • symbol: SAOUHSC_02741
  • product: amino acid ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2520722..2521417
  • length: 696
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGAAGGTAATTTATTACAGCAATTATTCAATTATTATGTTACGAACTTTGGTTATCTA
    TGGGATTTATTTTTCAAACACTTATTAATGTCTGTCTATGGTGTGCTGTTTGCAGCTTTA
    ATTGGTATTCCATTGGGAATCTTGCTTGCAAGATACACAAAACTTTCTGGATTTGTAATT
    ACAATTGCAAATATAATTCAAACAGTTCCAGTCATTGCAATGTTAGCTATTTTAATGTTA
    GTCATGGGCTTAGGTTCAGAAACAGTAGTTTTAACAGTGTTTTTATATGCGTTACTTCCA
    ATTATAAAAAACACTTATACTGGTATAGCTAGTGTTGATGCGAATATTAAGGATGCTGGC
    AAAGGTATGGGAATGACACGCAATCAAGTGCTACGAATGATTGAATTACCGTTATCTGTT
    TCGGTTATTATCGGTGGCATTCGTATTGCCTTGGTTGTTGCGATAGGTGTTGTTGCCGTT
    GGATCATTTATAGGAGCACCTACGCTTGGTGACATTGTGATTCGTGGTACAAATGCGACG
    GATGGCACAACGTTTATTTTAGCAGGTGCGATTCCGATTGCTATCATTGCAATCGTCATT
    GATGTACTATTAAGATTTTTAGAAAAACGATTAGACCCAACAACACGACATCGTAAAAAT
    CAATCTAATCATCGGCCGCAAAGTATTAATATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_02741
  • symbol: SAOUHSC_02741
  • description: amino acid ABC transporter permease
  • length: 231
  • theoretical pI: 10.1502
  • theoretical MW: 25025.9
  • GRAVY: 0.844156

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    choline ABC transporter, permease protein (TIGR03416; HMM-score: 86.1)
    and 10 more
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, permease protein (TIGR01183; HMM-score: 44.7)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 32.3)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 31.7)
    NifC-like ABC-type porter (TIGR01581; HMM-score: 22)
    2-aminoethylphosphonate ABC transport system, membrane component PhnV (TIGR03255; HMM-score: 19.6)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, permease protein (TIGR02141; HMM-score: 18.4)
    Cellular processes Cellular processes Pathogenesis autotransporter-associated beta strand repeat (TIGR02601; HMM-score: 10)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking autotransporter-associated beta strand repeat (TIGR02601; HMM-score: 10)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 9.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides celllulose biosynthesis operon protein BcsF/YhjT (TIGR03493; HMM-score: 5.4)
  • TheSEED  :
    • Choline ABC transport system, permease protein OpuBD
    Stress Response Osmotic stress Choline and Betaine Uptake and Betaine Biosynthesis  Osmotically activated L-carnitine/choline ABC transporter, permease protein OpuCD
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 87.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • ⊞DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9999
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0001
  • ⊞LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001453
    • TAT(Tat/SPI): 0.000164
    • LIPO(Sec/SPII): 0.001504
  • predicted transmembrane helices (TMHMM): 5

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVITIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAGKGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNATDGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • ⊞regulator: CodY* (repression) regulon

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser:  [3] 
    Expression Data Browser
    ⊟Multi-gene expression profiles



    Click on any data point to display a description of the corresponding condition!

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ Jump up to: 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_02741&oldid=101138"