From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08980 [old locus tag: SA1594 ]
  • pan locus tag?: SAUPAN004469000
  • symbol: SA_RS08980
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS08980 [old locus tag: SA1594 ]
  • symbol: SA_RS08980
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1833647..1833871
  • length: 225
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (1833647..1833871) NCBI
  • BioCyc: SA_RS08980 BioCyc
  • MicrobesOnline: see SA1594

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGATTACGCACATTTAAATTTAGAACATTTTTTTGCACGAAACGACGATTTAGATGTT
    ATAAGAGATCGCGCTGATTTCGTGATGATAAATAACTTCACTAATGAAATGATGTATCGT
    GATGGTCAAATTGAAGGCACGATTGATTTAAATCAGTACTATTATAAAAATAGATCAAAT
    GCAGCAAGTTTTATTATGATGGATTATAAAAAAGAAACTAAGTAA
    60
    120
    180
    225


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS08980 [old locus tag: SA1594 ]
  • symbol: SA_RS08980
  • description: hypothetical protein
  • length: 74
  • theoretical pI: 4.71869
  • theoretical MW: 8973.01
  • GRAVY: -0.767568

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA1594
  • PFAM:
    no clan defined DUF2672; Protein of unknown function (DUF2672) (PF10878; HMM-score: 13.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7163
    • Cytoplasmic Membrane Score: 0.0126
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.271
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001913
    • TAT(Tat/SPI): 0.000233
    • LIPO(Sec/SPII): 0.000402
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDYAHLNLEHFFARNDDLDVIRDRADFVMINNFTNEMMYRDGQIEGTIDLNQYYYKNRSNAASFIMMDYKKETK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]