Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS08180 [old locus tag: SAS049 ]
- pan locus tag?: SAUPAN004226000
- symbol: SA_RS08180
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAGTTTTATGGATAAAGCTAAAGACGCAGTAGAAAAATTTAAAAATAGCGATAATGAA
CAAGTTAAAAATGTAAAAGATAAGATAAATGAATATACAGGATCGAATAACGAAGAGAAA
AAAGAAAATGAAGATAAAGAGAAATAA60
120
147
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS08180 [old locus tag: SAS049 ]
- symbol: SA_RS08180
- description: hypothetical protein
- length: 48
- theoretical pI: 4.78677
- theoretical MW: 5655.14
- GRAVY: -1.89792
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAS049
- PFAM: no clan defined CdiI_2; CdiI immunity protein (PF18593; HMM-score: 13.7)YtxH; YtxH-like protein (PF12732; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8931
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0052
- Extracellular Score: 0.1015
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.104333
- TAT(Tat/SPI): 0.008115
- LIPO(Sec/SPII): 0.018002
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]