From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04320 [old locus tag: SA0758 ]
  • pan locus tag?: SAUPAN002819000
  • symbol: SA_RS04320
  • pan gene symbol?: trxP
  • synonym:
  • product: thiol reductase thioredoxin

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04320 [old locus tag: SA0758 ]
  • symbol: SA_RS04320
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 864749..865069
  • length: 321
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (864749..865069) NCBI
  • BioCyc: SA_RS04320 BioCyc
  • MicrobesOnline: see SA0758

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAAGCAATCAAAAGTAATGAATCATTTAAATCTATAATTAATAGCGATACACCTGTA
    ATTGTTAAATTTGAGGCAGGATGGTGCCCAGACTGTCGTGCTATGGATTTATGGATTGAC
    CCAATCGTAGAACAATATAATGATTACCAATGGTATACTGTTAATCGTGATGAATTAGAA
    GATGTAGTTGTTGAAAATGAAGTTATGGGTATCCCTAGCTTGCTAGTATTTAAAAACGGC
    GACAAAATTGCACACCTTCATTCAGCAAATGCTAAGTCACCTGAACAAGTTGAATCATTT
    TTAGCAGAAACTTTTAAATAA
    60
    120
    180
    240
    300
    321


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS04320 [old locus tag: SA0758 ]
  • symbol: SA_RS04320
  • description: thiol reductase thioredoxin
  • length: 106
  • theoretical pI: 4.22853
  • theoretical MW: 12138.6
  • GRAVY: -0.286792

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 56.2)
    and 3 more
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 34.1)
    protein disulfide isomerase (TIGR01130; HMM-score: 24.5)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 13.9)
  • TheSEED: see SA0758
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 62.4)
    and 8 more
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 20.1)
    Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 18.3)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 16.1)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 14.5)
    TXD17-like_Trx; Thioredoxin domain-containing protein 17-like, thioredoxin domain (PF06110; HMM-score: 13.4)
    HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 13.3)
    Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 12.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9873
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0123
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007842
    • TAT(Tat/SPI): 0.000181
    • LIPO(Sec/SPII): 0.001074
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MQAIKSNESFKSIINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]