From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04275 [old locus tag: SAS019 ]
  • pan locus tag?: SAUPAN002807000
  • symbol: SA_RS04275
  • pan gene symbol?:
  • synonym: tsaA
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04275 [old locus tag: SAS019 ]
  • symbol: SA_RS04275
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 859109..859369
  • length: 261
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (859109..859369) NCBI
  • BioCyc: SA_RS04275 BioCyc
  • MicrobesOnline: see SAS019

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATAACATTTTGTTAAATGCTATCAATATAGTTATTACTACCACTTTTGTTATCTTT
    AATATTTTAATCACATATAATAAAGATTTAGATGATTTATGTTGGCTCCTGCCTGGTATT
    ATCATTTGTGGTGTGATACTCATCGTATCCTTTACCATTGCAATGATAACTAAAAACTGG
    TTAAGTGAAATATTATTTTTTATAAATATCGTACTCGTTCTCTATTACATTTATCCTATT
    TTTTATAGTTTTATAGGTTAA
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS04275 [old locus tag: SAS019 ]
  • symbol: SA_RS04275
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 4.06264
  • theoretical MW: 9940.02
  • GRAVY: 1.43837

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAS019
  • PFAM:
    HAD (CL0137) PhoLip_ATPase_C; Phospholipid-translocating P-type ATPase C-terminal (PF16212; HMM-score: 11)
    and 1 more
    no clan defined DUF1029; Protein of unknown function (DUF1029) (PF06269; HMM-score: 8.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0004
    • Cytoplasmic Membrane Score: 0.9298
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0695
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001759
    • TAT(Tat/SPI): 0.000058
    • LIPO(Sec/SPII): 0.00567
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]