From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02940 [old locus tag: SA0502 ]
  • pan locus tag?: SAUPAN002316000
  • symbol: SA_RS02940
  • pan gene symbol?: rplGB
  • synonym:
  • product: 50S ribosomal protein L7ae-like protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS02940 [old locus tag: SA0502 ]
  • symbol: SA_RS02940
  • product: 50S ribosomal protein L7ae-like protein
  • replicon: chromosome
  • strand: +
  • coordinates: 587068..587322
  • length: 255
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (587068..587322) NCBI
  • BioCyc: SA_RS02940 BioCyc
  • MicrobesOnline: see SA0502

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGTCTAAGGAAAAAGTTGCACGCTTTAACAAACAACATTTTGTAGTTGGTCTTAAAGAA
    ACGCTTAAAGCGTTAAAGAAAGATCAAGTTACATCTTTGATTATTGCTGAAGACGTTGAA
    GTATATTTAATGACTCGCGTGTTAAGCCAAATCAATCAGAAAAATATACCTGTATCTTTT
    TTCAAAAGCAAACATGCTTTGGGTAAACATGTAGGTATTAACGTCAATGCGACAATAGTA
    GCATTGATTAAATGA
    60
    120
    180
    240
    255

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS02940 [old locus tag: SA0502 ]
  • symbol: SA_RS02940
  • description: 50S ribosomal protein L7ae-like protein
  • length: 84
  • theoretical pI: 10.8182
  • theoretical MW: 9446.19
  • GRAVY: 0.0607143

⊟Function[edit | edit source]

  • TIGRFAM:
    ribosomal protein eL8 (TIGR03677; HMM-score: 37.8)
  • TheSEED: see SA0502
  • PFAM:
    PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 39.1)
    and 3 more
    eRF1_3; eRF1 domain 3 (PF03465; HMM-score: 16.5)
    no clan defined DUF1694; Protein of unknown function (DUF1694) (PF07997; HMM-score: 13.8)
    Cas_Cas1; CRISPR associated protein Cas1 (PF01867; HMM-score: 13)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001767
    • TAT(Tat/SPI): 0.000214
    • LIPO(Sec/SPII): 0.00029
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA_RS02940&oldid=67406"