Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS01230 [old locus tag: SA0209 ]
- pan locus tag?: SAUPAN001067000
- symbol: SA_RS01230
- pan gene symbol?: —
- synonym:
- product: maltose ABC transporter permease
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781ATGACAAAGAAGAAAAACATATTAAAAGCAATCGGTATTTACAGTTTTATAGCGATGATG
TTTGTCATCATTTTATATCCACTACTGTGGACATTTGGCATTTCCCTTAATCCAGGTACG
AACTTGTATGGTGCCAAAATGATACCAGACAATGCAACATTTAAAAATTATGCATTCTTA
CTATTCGATGACAGTAGTCAATACCTGACTTGGTATAAAAATACGCTTATCGTAGCATCT
GCAAATGCACTGTTTAGTGTGATATTTGTCACGTTAACAGCATATGCTTTTTCTAGATAT
CGCTTTGTTGGTCGTAAATACGGGCTGATTACATTTTTGATTTTACAAATGTTCCCTGTA
TTAATGGCAATGGTCGCAATCTATATTTTGCTAAATACAATTGGTTTATTAGATTCTTTA
TTTGGACTAACACTGGTATATATTGGTGGATCAATACCGATGAATGCCTTTTTAGTGAAA
GGTTACTTCGATACGATTCCAAAAGAACTTGATGAATCTGCCAAAATTGATGGTGCAGGG
CATATGCGTATTTTCTTACAAATTATGCTTCCATTAGCTAAGCCGATTTTAGCAGTTGTT
GCTTTGTTCAATTTTATGGGACCATTTATGGACTTTATATTACCTAAAATACTATTAAGA
AGTCCTGAAAAATTCACATTAGCAGTTGGATTGTTCAACTTTATTAATGATAAGTATGCA
AATAATTTCACAGTGTTTGCAGCAGGGGCAATTATGATTGCAGTACCTATAGCAATCGTA
TTCTTGTTCTTGCAACGCTATTTAGTATCAGGTTTAACAACAGGTGCGACAAAAGGTTAG60
120
180
240
300
360
420
480
540
600
660
720
780
840
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS01230 [old locus tag: SA0209 ]
- symbol: SA_RS01230
- description: maltose ABC transporter permease
- length: 279
- theoretical pI: 10.05
- theoretical MW: 31154.3
- GRAVY: 0.813978
⊟Function[edit | edit source]
- TIGRFAM: NifC-like ABC-type porter (TIGR01581; HMM-score: 29.1)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, permease protein (TIGR03262; HMM-score: 28.1)Transport and binding proteins Anions sulfate ABC transporter, permease protein CysT (TIGR02139; HMM-score: 24.6)and 4 moreTransport and binding proteins Anions sulfate ABC transporter, permease protein (TIGR00969; HMM-score: 23.2)Transport and binding proteins Anions molybdate ABC transporter, permease protein (TIGR02141; HMM-score: 21.6)Transport and binding proteins Cations and iron carrying compounds K+-dependent Na+/Ca+ exchanger (TIGR00927; HMM-score: 8.3)Energy metabolism Electron transport cytochrome c oxidase, cbb3-type, CcoQ subunit (TIGR02736; EC 1.9.3.1; HMM-score: 6.6)
- TheSEED: see SA0209
- PFAM: BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 63.6)and 1 morePeptidase_MA (CL0126) DUF3267; Putative zincin peptidase (PF11667; HMM-score: 14.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 6
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 1
- Cell wall & surface Score: 0
- Extracellular Score: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.09566
- TAT(Tat/SPI): 0.001248
- LIPO(Sec/SPII): 0.006185
- predicted transmembrane helices (TMHMM): 6
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGISLNPGTNLYGAKMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTAYAFSRYRFVGRKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPMNAFLVKGYFDTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFILPKILLRSPEKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTTGATKG
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CcpA, MalR see SA0209
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]