From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS13850 [old locus tag: SAUSA300_2493 ]
  • pan locus tag?: SAUPAN006219000
  • symbol: SAUSA300_RS13850
  • pan gene symbol?: cwrA
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS13850 [old locus tag: SAUSA300_2493 ]
  • symbol: SAUSA300_RS13850
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2696111..2696302
  • length: 192
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAGAATATTAATTACAGGCACAGTTGCTATCTTAATCATTCTAGGTTTGGTCAAAACG
    ATACAAGATTACGAAATGACAAACGACACGAGTCGTCAGTTGTCAGACAACAAAGATGAT
    GATAAAGTCATCCATCTTAATAATTTTAAAAATTTACATGCGAAAGAATTTAACCCATCT
    GATTTCTTTTAA
    60
    120
    180
    192

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS13850 [old locus tag: SAUSA300_2493 ]
  • symbol: SAUSA300_RS13850
  • description: hypothetical protein
  • length: 63
  • theoretical pI: 5.58216
  • theoretical MW: 7266.26
  • GRAVY: -0.233333

Function[edit | edit source]

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0009
    • Cytoplasmic Membrane Score: 0.4968
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.5015
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 20 aa
    • SP(Sec/SPI): 0.461237
    • TAT(Tat/SPI): 0.000815
    • LIPO(Sec/SPII): 0.122821
    • Cleavage Site: CS pos: 20-21. VKT-IQ. Pr: 0.0791
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPSDFF

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]