Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS12945 [old locus tag: SAUSA300_2345 ]
- pan locus tag?: SAUPAN005931000
- symbol: SAUSA300_RS12945
- pan gene symbol?: nasE
- synonym: nirD
- product: nitrite reductase (NAD(P)H) small subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS12945 [old locus tag: SAUSA300_2345 ]
- symbol: SAUSA300_RS12945
- product: nitrite reductase (NAD(P)H) small subunit
- replicon: chromosome
- strand: -
- coordinates: 2521758..2522072
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2521758..2522072) NCBI
- BioCyc: SAUSA300_RS12945 BioCyc
- MicrobesOnline: see SAUSA300_2345
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGAAACAAAAGAAAAAATTAAAGTGACAACTATAGATGAATTAACACCCCTAATTGGA
AAAAAGGTTATTGTCAAAGGCAAAGAGGTAGGGTTGTTTTTAACAGAAAGTGGCAAAATT
CATGCGATTCACAATATCTGTCCACACAAACAAGGACCATTGTCTGAAGGGACAGTGAGT
GGGGAATATGTATTTTGCCCGCTCCACGATCAAAAAATTGATTTAAATACAGGTATTGTT
CAAGAACCTGATGAAGGTTGTGTAGATGTTTATGAGGTAGAAGTTACAGACGGGAACGTA
TATATATGTCTGTAG60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS12945 [old locus tag: SAUSA300_2345 ]
- symbol: SAUSA300_RS12945
- description: nitrite reductase (NAD(P)H) small subunit
- length: 104
- theoretical pI: 4.70663
- theoretical MW: 11437.1
- GRAVY: -0.106731
⊟Function[edit | edit source]
- reaction: EC 1.7.1.4? ExPASyNitrite reductase (NAD(P)H) Ammonia + 3 NAD(P)+ + 2 H2O = nitrite + 3 NAD(P)H
- TIGRFAM: Central intermediary metabolism Nitrogen metabolism nitrite reductase [NAD(P)H], small subunit (TIGR02378; EC 1.7.1.4; HMM-score: 82.3)and 1 moreRieske [2Fe-2S] domain protein, MocE subfamily (TIGR02377; HMM-score: 35.7)
- TheSEED: see SAUSA300_2345
- PFAM: ISP-domain (CL0516) Rieske_2; Rieske-like [2Fe-2S] domain (PF13806; HMM-score: 64.4)Rieske; Rieske [2Fe-2S] domain (PF00355; HMM-score: 55.8)and 1 moreRieske_4; Soluble Rieske-type ferredoxin (PF22543; HMM-score: 21.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.997
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0
- Extracellular Score: 0.002
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011677
- TAT(Tat/SPI): 0.000435
- LIPO(Sec/SPII): 0.000882
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446370367 NCBI
- RefSeq: WP_000448222 NCBI
- UniProt: see SAUSA300_2345
⊟Protein sequence[edit | edit source]
- METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: NreC*, Rex see SAUSA300_2345
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.