Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS11740 [old locus tag: SAUSA300_2132 ]
- pan locus tag?: SAUPAN005562000
- symbol: SAUSA300_RS11740
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS11740 [old locus tag: SAUSA300_2132 ]
- symbol: SAUSA300_RS11740
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2305724..2305984
- length: 261
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2305724..2305984) NCBI
- BioCyc: SAUSA300_RS11740 BioCyc
- MicrobesOnline: see SAUSA300_2132
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCAATGACAGTAAAAAAGGATAATAATGAAGTGCGTATTCAATGGAGAGTTGCTGAT
ATCAAAATTCCTACAAGTGAAATTAAAAATATTACACAAGACCAAGATATTCATGCAGTT
CCTAAATTAGACAGCAAAGATGTATCTAGAATCGGCTCAACGTTTGGTAAAACGAATCGC
GTTATTATCGATACTGAAGACCACGAATACATTATTTATACTCAAAATGATCAAAAAGTT
TACAATGAATTAACTAAATAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS11740 [old locus tag: SAUSA300_2132 ]
- symbol: SAUSA300_RS11740
- description: hypothetical protein
- length: 86
- theoretical pI: 6.52717
- theoretical MW: 10006.2
- GRAVY: -0.768605
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_2132
- PFAM: PH (CL0266) bPH_8; SunI-like bacterial PH domain (PF23491; HMM-score: 90.6)and 2 morebPH_5; Bacterial PH domain (PF10882; HMM-score: 20.7)no clan defined FmdE; FmdE, Molybdenum formylmethanofuran dehydrogenase operon (PF02663; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3248
- Cytoplasmic Membrane Score: 0.3219
- Cell wall & surface Score: 0.0015
- Extracellular Score: 0.3517
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005408
- TAT(Tat/SPI): 0.000282
- LIPO(Sec/SPII): 0.001307
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447174679 NCBI
- RefSeq: WP_001251935 NCBI
- UniProt: see SAUSA300_2132
⊟Protein sequence[edit | edit source]
- MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNRVIIDTEDHEYIIYTQNDQKVYNELTK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CcpA see SAUSA300_2132
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]