Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07460 [old locus tag: SAUSA300_1366 ]
- pan locus tag?: SAUPAN003941000
- symbol: SAUSA300_RS07460
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07460 [old locus tag: SAUSA300_1366 ]
- symbol: SAUSA300_RS07460
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1533712..1533828
- length: 117
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1533712..1533828) NCBI
- BioCyc: SAUSA300_RS07460 BioCyc
- MicrobesOnline: see SAUSA300_1366
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61GTGCAACGCTTAACGCATATACAAAATGAATGTGCTGATAATGATTTACTCAAATTAAAA
GGTGATTTTTATTCAATGATGAATGAAAGTTGCCTTTTTATTTTTGGTAAAAGTTAA60
117
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07460 [old locus tag: SAUSA300_1366 ]
- symbol: SAUSA300_RS07460
- description: hypothetical protein
- length: 38
- theoretical pI: 5.62759
- theoretical MW: 4442.13
- GRAVY: -0.281579
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1366
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6492
- Cytoplasmic Membrane Score: 0.0129
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.3379
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.258774
- TAT(Tat/SPI): 0.003864
- LIPO(Sec/SPII): 0.026045
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 487705713 NCBI
- RefSeq: WP_001789945 NCBI
- UniProt: see SAUSA300_1366
⊟Protein sequence[edit | edit source]
- MQRLTHIQNECADNDLLKLKGDFYSMMNESCLFIFGKS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.