Jump to navigation
		Jump to search
		
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07205 [old locus tag: SAUSA300_1323 ]
- pan locus tag?: SAUPAN003862000
- symbol: SAUSA300_RS07205
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07205 [old locus tag: SAUSA300_1323 ]
- symbol: SAUSA300_RS07205
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1454404..1454655
- length: 252
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1454404..1454655) NCBI
- BioCyc: SAUSA300_RS07205 BioCyc
- MicrobesOnline: see SAUSA300_1323
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241ATGAAAATTATATCTATATCAGAAACACCGAACCACAACACAATGAAGATTACACTTAGT
 GAAAGCAGAGAAGGTATGACATCAGATACGTATACTAAAGTTGATGATTCACAGCCAGCA
 TTTATTAATGACATCTTAAAGGTTGAAGGCGTTAAATCAATTTTCCATGTTATGGACTTT
 ATTTCAGTAGATAAAGAAAATGACGCAAATTGGGAAACAGTATTGCCAAAAGTAGAGGCT
 GTATTCGAATAA60
 120
 180
 240
 252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07205 [old locus tag: SAUSA300_1323 ]
- symbol: SAUSA300_RS07205
- description: hypothetical protein
- length: 83
- theoretical pI: 4.33059
- theoretical MW: 9406.57
- GRAVY: -0.308434
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1323
- PFAM: Arg_repressor_C (CL0738) Nfu_N; Scaffold protein Nfu/NifU N terminal (PF08712; HMM-score: 67.2)and 1 moreno clan defined DUF7056; Domain of unknown function (DUF7056) (PF23158; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.9903
- Cytoplasmic Membrane Score: 0.0017
- Cell wall & surface Score: 0
- Extracellular Score: 0.0079
 
- LocateP:
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.005499
- TAT(Tat/SPI): 0.000304
- LIPO(Sec/SPII): 0.00068
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446614596 NCBI
- RefSeq: WP_000691942 NCBI
- UniProt: see SAUSA300_1323
⊟Protein sequence[edit | edit source]
- MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]