From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS04265 [old locus tag: SAUSA300_0790 ]
  • pan locus tag?: SAUPAN002820000
  • symbol: SAUSA300_RS04265
  • pan gene symbol?:
  • synonym:
  • product: arsenate reductase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS04265 [old locus tag: SAUSA300_0790 ]
  • symbol: SAUSA300_RS04265
  • product: arsenate reductase
  • replicon: chromosome
  • strand: +
  • coordinates: 875683..876039
  • length: 357
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAATTTTACCAATATAAGAATTGTACAACTTGTAAAAAGGCAGCAAAGTTTTTA
    GATGAATATGGCGTAAGTTATGAACCAATTGATATCGTTCAACATACACCTACAATAAAT
    GAATTTAAAACAATAATTGCAAATACAGGCGTAGAAATTAATAAATTGTTTAATACACAC
    GGCGCGAAATATCGTGAGCTTGATTTGAAAAATAAATTACAAACTTTATCAGATGATGAA
    AAGTTAGAGTTGTTATCATCTGATGGTATGTTAGTAAAGCGTCCTCTAGCAGTAATGGGC
    GATAAGATAACATTAGGATTTAAAGAAGATCAATATAAAGAGACTTGGTTAGCGTAA
    60
    120
    180
    240
    300
    357

Protein[edit | edit source]

Protein Data Bank: 2M46

General[edit | edit source]

  • locus tag: SAUSA300_RS04265 [old locus tag: SAUSA300_0790 ]
  • symbol: SAUSA300_RS04265
  • description: arsenate reductase
  • length: 118
  • theoretical pI: 7.40662
  • theoretical MW: 13599.6
  • GRAVY: -0.445763

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 155)
    and 7 more
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 40.2)
    Cellular processes Cellular processes Detoxification arsenate reductase (glutaredoxin) (TIGR00014; EC 1.20.4.1; HMM-score: 39.4)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 32.5)
    Unknown function General nitrogenase-associated protein (TIGR01616; HMM-score: 30.5)
    glutaredoxin-like protein (TIGR02200; HMM-score: 24.3)
    Metabolism Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 22.5)
    glutaredoxin-family domain (TIGR02190; HMM-score: 12.7)
  • TheSEED: see SAUSA300_0790
  • PFAM:
    Thioredoxin (CL0172) ArsC; ArsC family (PF03960; HMM-score: 72.9)
    and 4 more
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 32.7)
    no clan defined IMPa_helical; Immunomodulating metalloprotease helical domain (PF18642; HMM-score: 15.2)
    RNase_3_N; Ribonuclease III N-terminal domain (PF18497; HMM-score: 14.2)
    Thioredoxin (CL0172) Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9869
    • Cytoplasmic Membrane Score: 0.0014
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0114
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006247
    • TAT(Tat/SPI): 0.000081
    • LIPO(Sec/SPII): 0.001464
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]