Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS04110 [old locus tag: SAUSA300_0762 ]
- pan locus tag?: SAUPAN002712000
- symbol: SAUSA300_RS04110
- pan gene symbol?: secG
- synonym:
- product: protein-export membrane protein SecG
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS04110 [old locus tag: SAUSA300_0762 ]
- symbol: SAUSA300_RS04110
- product: protein-export membrane protein SecG
- replicon: chromosome
- strand: +
- coordinates: 850388..850621
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (850388..850621) NCBI
- BioCyc: SAUSA300_RS04110 BioCyc
- MicrobesOnline: see SAUSA300_0762
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCATACATTTTTAATCGTATTATTAATCATTGATTGTATTGCATTAATAACTGTTGTA
CTACTCCAAGAAGGTAAAAGCAGTGGACTTTCAGGTGCCATCAGTGGTGGTGCTGAGCAG
TTATTCGGTAAACAAAAACAACGTGGCGTCGATTTATTCTTAAATAGATTAACAATTATT
TTATCAATATTATTTTTTGTACTTATGATTTGCATAAGTTATCTTGGTATGTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS04110 [old locus tag: SAUSA300_0762 ]
- symbol: SAUSA300_RS04110
- description: protein-export membrane protein SecG
- length: 77
- theoretical pI: 8.22953
- theoretical MW: 8399.2
- GRAVY: 1.17922
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecG subunit (TIGR00810; HMM-score: 82.4)
- TheSEED: see SAUSA300_0762
- PFAM: no clan defined SecG; Preprotein translocase SecG subunit (PF03840; HMM-score: 84.1)and 1 moreDUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 8.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9963
- Cell wall & surface Score: 0
- Extracellular Score: 0.0037
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.07348
- TAT(Tat/SPI): 0.00059
- LIPO(Sec/SPII): 0.060001
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI: 446478906 NCBI
- RefSeq: WP_000556760 NCBI
- UniProt: see SAUSA300_0762
⊟Protein sequence[edit | edit source]
- MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTIILSILFFVLMICISYLGM
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.