From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS03005
  • pan locus tag?:
  • symbol: SAUSA300_RS03005
  • pan gene symbol?:
  • synonym:
  • product: protein VraX

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS03005
  • symbol: SAUSA300_RS03005
  • product: protein VraX
  • replicon: chromosome
  • strand: -
  • coordinates: 636608..636775
  • length: 168
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (636608..636775) NCBI
  • BioCyc: SAUSA300_RS03005 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGATTATTTATCGACAGTATCACCATGAAGGCGCACCAGTTTATGAAATTATAACCAAA
    ACGTTTCAGCATGTTTCAATTAAATGTGACGATTCATTTAGTGATACTGAAATATTCAAA
    TTGCTCTCTTTATTACAAGACGATATAGATCATATGAAAGTTAGTTAA
    60
    120
    168

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS03005
  • symbol: SAUSA300_RS03005
  • description: protein VraX
  • length: 55
  • theoretical pI: 5.43379
  • theoretical MW: 6500.38
  • GRAVY: -0.201818

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined VraX; Family of unknown function (PF17412; HMM-score: 135.5)
    and 1 more
    WY-like (CL0807) RXLR_WY; RXLR phytopathogen effector protein WY-domain (PF18634; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.569
    • Cytoplasmic Membrane Score: 0.0701
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.3605
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00804
    • TAT(Tat/SPI): 0.000622
    • LIPO(Sec/SPII): 0.011168
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446510469 NCBI
  • RefSeq: WP_000587958 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: VraR (activation) regulon
    VraR(TF)response regulator important for resistance against cell-wall targeting antibiotics;  [1] [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
    Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
    Mol Microbiol: 2003, 49(3);807-21
    [PubMed:12864861] [WorldCat.org] [DOI] (P p)
  2. Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
    VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
    Antimicrob Agents Chemother: 2013, 57(1);83-95
    [PubMed:23070169] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]