Jump to navigation
		Jump to search
		
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS02495 [old locus tag: SAUSA300_0465 ]
- pan locus tag?: SAUPAN002224000
- symbol: SAUSA300_RS02495
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS02495 [old locus tag: SAUSA300_0465 ]
- symbol: SAUSA300_RS02495
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 524414..524662
- length: 249
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (524414..524662) NCBI
- BioCyc: SAUSA300_RS02495 BioCyc
- MicrobesOnline: see SAUSA300_0465
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241ATGGATAGTCATTTTGTATATATTGTAAAATGTAGTGATGGAAGTTTATATACAGGATAC
 GCTAAAGACGTTAATGCACGTGTTGAAAAACATAACCGAGGTCAAGGAGCCAAATATACG
 AAAGTAAGACGTCCGGTGCATTTAGTTTATCAAGAAATGTATGAGACAAAGTCTGAAGCA
 TTGAAGCGTGAATATGAAATTAAAACTTATACCAGACAAAAGAAATTGCGATTAATTAAG
 GAGCGATAG60
 120
 180
 240
 249
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS02495 [old locus tag: SAUSA300_0465 ]
- symbol: SAUSA300_RS02495
- description: hypothetical protein
- length: 82
- theoretical pI: 10.238
- theoretical MW: 9831.25
- GRAVY: -1.01341
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0465
- PFAM: GIY-YIG (CL0418) GIY-YIG; GIY-YIG catalytic domain (PF01541; HMM-score: 66.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.9581
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.0397
 
- LocateP:
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.015705
- TAT(Tat/SPI): 0.001096
- LIPO(Sec/SPII): 0.007134
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446299209 NCBI
- RefSeq: WP_000377064 NCBI
- UniProt: see SAUSA300_0465
⊟Protein sequence[edit | edit source]
- MDSHFVYIVKCSDGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIKTYTRQKKLRLIKER
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]