Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS01935 [old locus tag: SAUSA300_0365 ]
- pan locus tag?: SAUPAN001910000
- symbol: SAUSA300_RS01935
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS01935 [old locus tag: SAUSA300_0365 ]
- symbol: SAUSA300_RS01935
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 418338..418529
- length: 192
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (418338..418529) NCBI
- BioCyc: SAUSA300_RS01935 BioCyc
- MicrobesOnline: see SAUSA300_0365
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATTTAAATATTGATTGGTCTAAAGATTTTCAAGAATTCCAAGAGATACTTAATAGT
GGTATTCATCCTGAATGGCTTTATTGTGCAAAGGCTAATCTTGTTTTAGAGCCTGCTTAT
ACTGGCGAAGGCAAACAATTTTTCAGCACTCAAGATATTATTAACGCGAGTAAAATTATT
CCATTCTTTTAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS01935 [old locus tag: SAUSA300_0365 ]
- symbol: SAUSA300_RS01935
- description: hypothetical protein
- length: 63
- theoretical pI: 4.28853
- theoretical MW: 7312.24
- GRAVY: -0.161905
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0365
- PFAM: no clan defined ASXH; Asx homology domain (PF13919; HMM-score: 13.3)DUF3741; Protein of unknown function (DUF3741) (PF12552; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9566
- Cytoplasmic Membrane Score: 0.0075
- Cell wall & surface Score: 0
- Extracellular Score: 0.0358
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.022116
- TAT(Tat/SPI): 0.000706
- LIPO(Sec/SPII): 0.001071
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446975227 NCBI
- RefSeq: WP_001052483 NCBI
- UniProt: see SAUSA300_0365
⊟Protein sequence[edit | edit source]
- MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGKQFFSTQDIINASKIIPFF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]