From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1703 [new locus tag: SAUSA300_RS09300 ]
  • pan locus tag?: SAUPAN004440000
  • symbol: SAUSA300_1703
  • pan gene symbol?: —
  • synonym:
  • product: rhodanese-like domain-containing protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1703 [new locus tag: SAUSA300_RS09300 ]
  • symbol: SAUSA300_1703
  • product: rhodanese-like domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1884794..1885105
  • length: 312
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAGTCAATTACTACAGATGAATTAAAAAATAAACTTTTAGAATCTAAACCAGTTCAA
    ATTGTTGATGTTCGTACTGATGAAGAAACAGCAATGGGATATATTCCTAATGCAAAGTTA
    ATTCCAATGGATACCATTCCGGATAATTTAAATTCATTTAATAAAAATGAAATATATTAT
    ATTGTATGTGCTGGTGGAGTTCGAAGCGCTAAAGTTGTAGAATATTTAGAGGCAAATGGC
    ATTGATGCCGTAAATGTCGAAGGCGGCATGCACGCATGGGGCGATGAAGGTTTGGAAATA
    AAAAGTATTTAA
    60
    120
    180
    240
    300
    312

⊟Protein[edit | edit source]

Protein Data Bank: 3IWH
Protein Data Bank: 3MZZ

⊟General[edit | edit source]

  • locus tag: SAUSA300_1703 [new locus tag: SAUSA300_RS09300 ]
  • symbol: SAUSA300_1703
  • description: rhodanese-like domain-containing protein
  • length: 103
  • theoretical pI: 4.30237
  • theoretical MW: 11343.9
  • GRAVY: -0.220388

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 24)
    thiazole biosynthesis domain (TIGR04271; HMM-score: 24)
    and 2 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification selenouridine synthase, SelU N-terminal-like subunit (TIGR04568; HMM-score: 13.1)
    phage shock operon rhodanese PspE (TIGR02981; EC 2.8.1.1; HMM-score: 12.9)
  • TheSEED  :
    • Ankyrin
    • Rhodanese domain protein
    Potassium metabolism Potassium metabolism - no subcategory Glutathione-regulated potassium-efflux system and associated functions  Rhodanese-like domain protein
    and 1 more
    Stress Response Oxidative stress Glutaredoxins  Rhodanese-like domain protein
  • PFAM:
    Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 42.9)
    and 2 more
    5_3_exonuc_C (CL0464) RNaseH_C; T4 RNase H, C terminal (PF09293; HMM-score: 13.4)
    NADP_Rossmann (CL0063) CoA_binding_2; CoA binding domain (PF13380; HMM-score: 12.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.01276
    • TAT(Tat/SPI): 0.000684
    • LIPO(Sec/SPII): 0.001797
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYYIVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAUSA300_1703&oldid=59241"