⊟Summary[edit | edit source]
- pan ID?: SAUPAN003030000
- symbol?: dltX
- synonym:
- description?: teichoic acid D-Ala incorporation-associated protein DltX
- teichoic acid D-Ala incorporation-associated protein DltX
- D-Ala-teichoic acid biosynthesis family protein
- D-Ala-teichoic acid biosynthesis protein
- membrane protein
descriptions from strain specific annotations:
- strand?: +
- coordinates?: 3420956..3421159
- synteny block?: BlockID0021380
- occurrence?: in 94% of 34 strains
dltX: D-alanyl-tyrosine acyl shuttle protein [1]
DltX is a part of the D-alanylation pathway of extracellular lipoteichoic acid modifications
• In the LTA D-alanylation pathway, D-alanine is activated (adenylylated) by DltA and thioesterified onto the phosphopantetheinylated carrier protein DltC. DltB transfers the D-alanine from DltC to an active site tyrosine of the acyl shuttle microprotein DltX and flips it to the outer leaflet of the membrane. Once on the outer leaflet, DltD can transfer the D-alanine from D-alanyl-DltX it to the 2-OH of the extracellular poly-glycerophosphate LTA.
• Under high salt conditions, the alternate sigma factor SigB activates LTA glycosylation and represses LTA D-alanylation.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
COL | |
N315 | |
NCTC8325 | |
Newman |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.307)
COL MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
N315 MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
NCTC8325 MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
Newman MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
**************************************************
- ↑ Bailey J Schultz, Eric D Snow, Suzanne Walker
Mechanism of D-alanine transfer to teichoic acids shows how bacteria acylate cell envelope polymers.
Nat Microbiol: 2023, 8(7);1318-1329
[PubMed:37308592] [WorldCat.org] [DOI] (I p)