From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS056 [new locus tag: SA_RS09985 ]
  • pan locus tag?: SAUPAN004972000
  • symbol: SAS056
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAS056 [new locus tag: SA_RS09985 ]
  • symbol: SAS056
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1992474..1992647
  • length: 174
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGTGGAATTTTATTAAATGTGTGTTTAAATTCGTATTTAGCTTAGTTGCTATTACAACA
    TTAGTTGCTGGTGTTGGTGTAGTAGCATTTGCTTATATCTTTAAAAAAGATTTTGAAGAT
    ATTGAAAGAAAAACTAAAGAAATTATTTCTGATATTGAAAGTAAAAATAACTAA
    60
    120
    174


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAS056 [new locus tag: SA_RS09985 ]
  • symbol: SAS056
  • description: hypothetical protein
  • length: 57
  • theoretical pI: 8.49847
  • theoretical MW: 6564.7
  • GRAVY: 0.445614

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein modification and repair cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
    Metabolism Energy metabolism Electron transport cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
  • TheSEED  :
    • FIG01108203: hypothetical protein
  • PFAM:
    no clan defined FixS; Cytochrome oxidase maturation protein cbb3-type (PF03597; HMM-score: 16.3)
    and 1 more
    DUF3918; Protein of unknown function (DUF3918) (PF13056; HMM-score: 11.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0005
    • Cytoplasmic Membrane Score: 0.4646
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.5348
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 5
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.384612
    • TAT(Tat/SPI): 0.007845
    • LIPO(Sec/SPII): 0.041173
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]