From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02661
  • pan locus tag?: SAUPAN005897000
  • symbol: SAOUHSC_02661
  • pan gene symbol?: scrA
  • synonym:
  • product: PTS system sucrose-specific transporter subunit IIBC

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02661
  • symbol: SAOUHSC_02661
  • product: PTS system sucrose-specific transporter subunit IIBC
  • replicon: chromosome
  • strand: -
  • coordinates: 2444928..2446371
  • length: 1443
  • essential: no DEG other strains
  • comment: Based on the resequencing performed by Berscheid et al., 2012 [1], SAOUHSC_02661 was merged with SAOUHSC_02662.

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    ATGAATTATAAGCAATCCGCAGAAGAAATTTTGAACGCGATAGGCGGAGAAGAGAATTTA
    GATGCAATGGCGCATTGTGCAACGAGACTACGATTAGTTTTAAATGATGAAAGTTTAGTA
    AATGAAGAGGCGCTAAACAATATGGATGTAGTTAAAGGGACGTTTTCTACTGGGGGACAA
    TACCAAATTATTATTGGGTCTGGTACAGTCAATAAAGTATTTAGTGAACTGGAAAAATTA
    ACTGGAAAAGAAGCATCAACCACTTCGGAAGTCAAAGCACAATCTGCTAAAAATATGAAT
    CCGTTACAGCGATTTGTAAAAATGCTTTCAGATATCTTTGTTCCGATTATACCAGCCATC
    GTTGCTGGTGGTTTATTAATGGGGTTAAATAACATTTTGACTGCGAAAGATTTATTCTTT
    TCAGGTAAATCATTGATAGATGTATATAGTCAATTTGCTGGATTAGCTGAAATGATAAAT
    GTTTTTGCGAATGCACCATTTACATTATTACCAATTTTAATTGGATTTAGTGCAGCAAAA
    CGCTTTGGTGGCAATCCATTTTTAGGTGCTGCATTAGGTATGATACTAGTTCATCCATCG
    CTAATGAGCGCATACGATTTCCCAAAAGCAGTTGAAGCAGGTAAGGCTATTCCATATTGG
    GATGTTTTTGGTTTGCATATTAATCAAGTAGGTTATCAAGGACAAGTGTTACCTATGCTT
    GTAGCAGCTTATATCTTAGCCTCAATTGAAAAAGGGTTACGCAAAGTTATTCCAACGGTG
    TTAGATAATTTGTTAACACCATTGTTATCTATTTTTATAACAGCATTTCTAACATTTTCA
    TTTGTAGGTCCAATCACTCGACAATTAGGTTACTGGTTATCAGATGGTTTAACATGGCTT
    TATGAATTTGGTGGTGCAATTGGTGGATTAATATTCGGATTATTGTATGCTCCGATTGTT
    ATTACAGGTATGCATCATAGCTTTATAGCTGTAGAAACGACATTAATTGCAGATGCCACT
    AAAACGGGTGGATCATTTATATTCCCGATTGCGACAATGTCTAATGTTGCACAAGGTGGT
    GCAGCAATTGCAGCGTTCTTTATTATTAAACAAAATAAGAAGTTAAAAGGTGTGGCATCT
    GCCGCAGGTATTTCAGCATTACTTGGTATTACAGAACCGGCTATGTTTGGTGTTAACTTA
    AAACTAAGATATCCATTTATTGGCGCTATCGTTGGATCAGGTATTGGTTCAGCATATATT
    GCTTTCTTCAAGGTTAAAGCAATCGCATTAGGAACTGCTGGATTGCCAGGATTTATTTCA
    ATCAATCCAGTACATGCAGGATGGTTACACTACTTTGTTGGTATGACAATATCATTCATC
    ATTGCTATAACAGTTACTTTAATTTTATCTAAAAGAAAAGCAAATAAAGAAGTTGTAGAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1443

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02661
  • symbol: SAOUHSC_02661
  • description: PTS system sucrose-specific transporter subunit IIBC
  • length: 480
  • theoretical pI: 9.25364
  • theoretical MW: 51217.9
  • GRAVY: 0.579583

Function[edit | edit source]

  • reaction:
    EC 2.7.1.69?  ExPASy
    Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195, 2.7.1.196, 2.7.1.197, 2.7.1.198, 2.7.1.199, 2.7.1.200, 2.7.1.201, 2.7.1.202, 2.7.1.203, 2.7.1.204, 2.7.1.205, 2.7.1.206, 2.7.1.207 and 2.7.1.208
  • TIGRFAM:
    PTS system, sucrose-specific IIBC component (TIGR01996; EC 2.7.1.69; HMM-score: 676.1)
    PTS system, trehalose-specific IIBC component (TIGR01992; EC 2.7.1.69; HMM-score: 553.8)
    and 10 more
    PTS system, beta-glucoside-specific IIABC component (TIGR01995; EC 2.7.1.69; HMM-score: 369.4)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, maltose and glucose-specific subfamily, IIC component (TIGR00852; HMM-score: 273.1)
    Signal transduction Signal transduction PTS PTS system, maltose and glucose-specific subfamily, IIC component (TIGR00852; HMM-score: 273.1)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, glucose-like IIB component (TIGR00826; EC 2.7.1.69; HMM-score: 86.5)
    Signal transduction Signal transduction PTS PTS system, glucose-like IIB component (TIGR00826; EC 2.7.1.69; HMM-score: 86.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, N-acetylglucosamine-specific IIBC component (TIGR01998; EC 2.7.1.69; HMM-score: 41.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, alpha-glucoside-specific IIBC component (TIGR02005; EC 2.7.1.69; HMM-score: 38.4)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, maltose and glucose-specific IIBC component (TIGR02004; EC 2.7.1.69; HMM-score: 35.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, glucose-specific IIBC component (TIGR02002; EC 2.7.1.69; HMM-score: 27.1)
    glycopeptide, sublancin family (TIGR04196; HMM-score: 13.8)
  • TheSEED  :
    • PTS system, sucrose-specific IIB component (EC 2.7.1.69)
    • PTS system, sucrose-specific IIC component (EC 2.7.1.69)
    Carbohydrates Di- and oligosaccharides Sucrose utilization  PTS system, sucrose-specific IIB component (EC 2.7.1.69)
    and 1 more
    Carbohydrates Di- and oligosaccharides Sucrose utilization  PTS system, sucrose-specific IIC component (EC 2.7.1.69)
  • PFAM:
    PTS_EIIC (CL0493) PTS_EIIC; Phosphotransferase system, EIIC (PF02378; HMM-score: 224.1)
    and 3 more
    no clan defined PTS_EIIB; phosphotransferase system, EIIB (PF00367; HMM-score: 53.3)
    YvrJ; YvrJ protein family (PF12841; HMM-score: 13.4)
    GPCR_A (CL0192) Ceramidase; Ceramidase (PF05875; HMM-score: 11.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 10
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9994
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0006
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011369
    • TAT(Tat/SPI): 0.000773
    • LIPO(Sec/SPII): 0.00117
  • predicted transmembrane helices (TMHMM): 8

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNYKQSAEEILNAIGGEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQYQIIIGSGTVNKVFSELEKLTGKEASTTSEVKAQSAKNMNPLQRFVKMLSDIFVPIIPAIVAGGLLMGLNNILTAKDLFFSGKSLIDVYSQFAGLAEMINVFANAPFTLLPILIGFSAAKRFGGNPFLGAALGMILVHPSLMSAYDFPKAVEAGKAIPYWDVFGLHINQVGYQGQVLPMLVAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWLYEFGGAIGGLIFGLLYAPIVITGMHHSFIAVETTLIADATKTGGSFIFPIATMSNVAQGGAAIAAFFIIKQNKKLKGVASAAGISALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSAYIAFFKVKAIALGTAGLPGFISINPVHAGWLHYFVGMTISFIIAITVTLILSKRKANKEVVE

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Anne Berscheid, Peter Sass, Konstantin Weber-Lassalle, Ambrose L Cheung, Gabriele Bierbaum
    Revisiting the genomes of the Staphylococcus aureus strains NCTC 8325 and RN4220.
    Int J Med Microbiol: 2012, 302(2);84-7
    [PubMed:22417616] [WorldCat.org] [DOI] (I p)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]