Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00888
- pan locus tag?: SAUPAN003052000
- symbol: SAOUHSC_00888
- pan gene symbol?: mnhB1
- synonym:
- product: monovalent cation/H+ antiporter subunit B
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00888
- symbol: SAOUHSC_00888
- product: monovalent cation/H+ antiporter subunit B
- replicon: chromosome
- strand: -
- coordinates: 851131..851559
- length: 429
- essential: no [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921734 NCBI
- RefSeq: YP_499441 NCBI
- BioCyc: G1I0R-831 BioCyc
- MicrobesOnline: 1289352 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATAGACAACAAAATGATCTAATTTTGCAATTTGCTGCAGTTATTATCTTTTTCATG
GTAATGGTCTTTGGTTTTTCACTTTTCTTAGCAGGACATTATACACCTGGTGGCGGTTTC
GTCGGCGGATTATTATTCGCAAGTTCACTTGTTATCATTACGATTGCATTTGATATAGAA
ACAATGCGTAAAATTTTCCCATTAGATTTTAAAATCTTGATAGGTATCGGATTAGTTTTT
TGTATTGCGACGCCTATCGCAAGTTGGTTTTTAGGCAAAAATTTCTTTACGCATGTCACA
TTTGATATACCGTTATTTATATTAGAACCTGTTCATATGACAACAGCAGTATTCTTTGAT
TTCGGTGTTTTATGTGCAGTAGTTGGTACTGTCATGACAATTATTATTTCGATTGGAGAG
AACGAATAG60
120
180
240
300
360
420
429
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00888
- symbol: SAOUHSC_00888
- description: monovalent cation/H+ antiporter subunit B
- length: 142
- theoretical pI: 4.88938
- theoretical MW: 15681.7
- GRAVY: 1.19155
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds monovalent cation:proton antiporter (TIGR00943; HMM-score: 160.7)
- TheSEED :
- Na(+) H(+) antiporter subunit B (TC 2.A.63.1.3)
- PFAM: no clan defined MnhB; Domain related to MnhB subunit of Na+/H+ antiporter (PF04039; HMM-score: 105.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9996
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004243
- TAT(Tat/SPI): 0.000461
- LIPO(Sec/SPII): 0.00489
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIETMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFDFGVLCAVVGTVMTIIISIGENE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_00883 < SAOUHSC_00884 < SAOUHSC_00885 < SAOUHSC_00886 < SAOUHSC_00887 < SAOUHSC_00888 < SAOUHSC_00889 < SAOUHSC_00890predicted SigA promoter [2] : SAOUHSC_00883 < SAOUHSC_00884 < SAOUHSC_00885 < SAOUHSC_00886 < SAOUHSC_00887 < SAOUHSC_00888 < SAOUHSC_00889
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [2]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ 2.0 2.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
