⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00665
- pan locus tag?: SAUPAN002538000
- symbol: SAOUHSC_00665
- pan gene symbol?: graR
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00665
- symbol: SAOUHSC_00665
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 652088..652762
- length: 675
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919955 NCBI
- RefSeq: YP_499224 NCBI
- BioCyc: G1I0R-619 BioCyc
- MicrobesOnline: 1289134 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGCAAATACTACTAGTAGAAGATGACAATACTTTGTTTCAAGAATTGAAAAAAGAATTA
GAACAATGGGATTTTAATGTTGCTGGTATTGAAGATTTCGGCAAAGTAATGGATACATTT
GAAAGTTTTAATCCTGAAATTGTTATATTGGATGTTCAATTACCTAAATATGATGGGTTT
TATTGGTGCAGAAAAATGAGAGAAGTTTCCAACGTACCAATATTATTTTTATCATCTCGT
GATAATCCAATGGATCAAGTGATGAGTATGGAACTTGGCGCAGATGATTATATGCAAAAA
CCGTTCTATACCAATGTATTAATTGCTAAATTACAAGCGATTTATCGTCGTGTCTATGAG
TTTACAGCTGAAGAAAAACGTACATTGACTTGGCAAGATGCTGTCGTTGATCTATCAAAA
GATAGTATACAAAAAGGTGATCAGACGATTTTCCTGTCCAAAACAGAAATGATTATATTA
GAAATTCTTATTACCAAAAAAAATCAAATCGTTTCGAGAGATACAATTATCACTGCATTA
TGGGATGATGAAGCATTTGTTAGTGATAATACGTTAACAGTAAATGTGAATCGTTTACGA
AAAAAATTATCTGAAATTAGTATGGATAGTGCAATCGAAACAAAAGTAGGAAAAGGATAT
ATGGCTCATGAATAA60
120
180
240
300
360
420
480
540
600
660
675
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00665
- symbol: SAOUHSC_00665
- description: hypothetical protein
- length: 224
- theoretical pI: 4.39684
- theoretical MW: 26078.8
- GRAVY: -0.257589
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 146.5)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 146.5)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 118.3)and 7 moreproteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 116.9)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 45)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 45)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 45)Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 44.2)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 38)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 19.4)
- TheSEED :
- Two-component response regulator BceR
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 79.4)HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 76)and 2 morePOTRA (CL0191) POTRA_1; POTRA domain, FtsQ-type (PF08478; HMM-score: 14.3)CheY (CL0304) PDE8A_N; PDE8A-like, N-terminal domain (PF23198; HMM-score: 14.2)
⊟Structure, modifications & cofactors[edit | edit source]
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9893
- Cytoplasmic Membrane Score: 0.0101
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0004
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001883
- TAT(Tat/SPI): 0.000104
- LIPO(Sec/SPII): 0.00034
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEFTAEEKRTLTWQDAVVDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [4] [5]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_00664 > SAOUHSC_00665 > SAOUHSC_00666 > SAOUHSC_00667 > SAOUHSC_00668predicted SigA promoter [6] : S251 > SAOUHSC_00664 > SAOUHSC_00665 > SAOUHSC_00666 > S252 > SAOUHSC_00667 > SAOUHSC_00668
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [6] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Min Li, Yuping Lai, Amer E Villaruz, David J Cha, Daniel E Sturdevant, Michael Otto
Gram-positive three-component antimicrobial peptide-sensing system.
Proc Natl Acad Sci U S A: 2007, 104(22);9469-74
[PubMed:17517597] [WorldCat.org] [DOI] (P p) - ↑ Silvia Herbert, Agnieszka Bera, Christiane Nerz, Dirk Kraus, Andreas Peschel, Christiane Goerke, Michael Meehl, Ambrose Cheung, Friedrich Götz
Molecular basis of resistance to muramidase and cationic antimicrobial peptide activity of lysozyme in staphylococci.
PLoS Pathog: 2007, 3(7);e102
[PubMed:17676995] [WorldCat.org] [DOI] (I p) - ↑ Mélanie Falord, Ulrike Mäder, Aurélia Hiron, Michel Débarbouillé, Tarek Msadek
Investigation of the Staphylococcus aureus GraSR regulon reveals novel links to virulence, stress response and cell wall signal transduction pathways.
PLoS One: 2011, 6(7);e21323
[PubMed:21765893] [WorldCat.org] [DOI] (I p) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 6.0 6.1 6.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Michael Meehl, Silvia Herbert, Friedrich Götz, Ambrose Cheung
Interaction of the GraRS two-component system with the VraFG ABC transporter to support vancomycin-intermediate resistance in Staphylococcus aureus.
Antimicrob Agents Chemother: 2007, 51(8);2679-89
[PubMed:17502406] [WorldCat.org] [DOI] (P p)Silvia Herbert, Agnieszka Bera, Christiane Nerz, Dirk Kraus, Andreas Peschel, Christiane Goerke, Michael Meehl, Ambrose Cheung, Friedrich Götz
Molecular basis of resistance to muramidase and cationic antimicrobial peptide activity of lysozyme in staphylococci.
PLoS Pathog: 2007, 3(7);e102
[PubMed:17676995] [WorldCat.org] [DOI] (I p)Dirk Kraus, Silvia Herbert, Sascha A Kristian, Arya Khosravi, Victor Nizet, Friedrich Götz, Andreas Peschel
The GraRS regulatory system controls Staphylococcus aureus susceptibility to antimicrobial host defenses.
BMC Microbiol: 2008, 8;85
[PubMed:18518949] [WorldCat.org] [DOI] (I e)