From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS11690 [old locus tag: SACOL2221 ]
  • symbol: SACOL_RS11690
  • product: 50S ribosomal protein L30
  • replicon: chromosome
  • strand: -
  • coordinates: 2298745..2298924
  • length: 180
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2298745..2298924) NCBI
  • BioCyc: SACOL_RS11690 BioCyc
  • MicrobesOnline: see SACOL2221

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGCTAAATTACAAATTACCCTCACTCGTAGTGTTATTGGTCGTCCTGAAACACAACGT
    AAAACTGTTGAAGCTTTAGGTCTTAAAAAGACTAACAGTTCAGTAGTTGTTGAAGATAAC
    CCTGCTATTCGTGGGCAAATCAACAAAGTTAAGCACTTAGTAACAGTAGAAGAAAAATAA
    60
    120
    180

Protein[edit | edit source]

Protein Data Bank: 4WCE

General[edit | edit source]

  • locus tag: SACOL_RS11690 [old locus tag: SACOL2221 ]
  • symbol: SACOL_RS11690
  • description: 50S ribosomal protein L30
  • length: 59
  • theoretical pI: 10.9014
  • theoretical MW: 6553.63
  • GRAVY: -0.4

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL30 (TIGR01308; HMM-score: 96)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL30 (TIGR01309; HMM-score: 22.1)
  • TheSEED: see SACOL2221
  • PFAM:
    no clan defined Ribosomal_L30; Ribosomal protein L30p/L7e (PF00327; HMM-score: 83.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8898
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0.0032
    • Extracellular Score: 0.1065
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008552
    • TAT(Tat/SPI): 0.00171
    • LIPO(Sec/SPII): 0.001474
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK

Experimental data[edit | edit source]

  • experimentally validated: see SACOL2221
  • protein localization: see SACOL2221
  • quantitative data / protein copy number per cell: see SACOL2221
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]