Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS10535 [old locus tag: SACOL2017 ]
- pan locus tag?: SAUPAN005266000
- symbol: SACOL_RS10535
- pan gene symbol?: groES
- synonym:
- product: co-chaperone GroES
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS10535 [old locus tag: SACOL2017 ]
- symbol: SACOL_RS10535
- product: co-chaperone GroES
- replicon: chromosome
- strand: -
- coordinates: 2077716..2078000
- length: 285
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (2077716..2078000) NCBI
- BioCyc: SACOL_RS10535 BioCyc
- MicrobesOnline: see SACOL2017
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCTAAAACCAATTGGAAATCGTGTGATTATTGAGAAAAAAGAACAAGAACAAACAACT
AAAAGTGGTATTGTTTTAACTGATAGTGCTAAAGAAAAATCAAACGAAGGCGTTATCGTT
GCAGTAGGAACTGGACGCCTATTAAATGATGGTACAAGAGTGACTCCTGAAGTGAAAGAA
GGGGACCGTGTCGTGTTCCAACAATATGCTGGTACAGAAGTTAAACGAGATAATGAAACA
TATCTGGTATTAAATGAAGAAGATATTTTAGCAGTTATTGAATAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS10535 [old locus tag: SACOL2017 ]
- symbol: SACOL_RS10535
- description: co-chaperone GroES
- length: 94
- theoretical pI: 4.57199
- theoretical MW: 10415.7
- GRAVY: -0.439362
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL2017
- PFAM: GroES (CL0296) Cpn10; Chaperonin 10 Kd subunit (PF00166; HMM-score: 121.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9985
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0
- Extracellular Score: 0.0012
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006421
- TAT(Tat/SPI): 0.000738
- LIPO(Sec/SPII): 0.001003
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKEGDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL2017
- protein localization: see SACOL2017
- quantitative data / protein copy number per cell: see SACOL2017
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: HrcA see SACOL2017
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]